ENSACAG00000000072 (Anolis carolinensis)
Description [+]
- Synonyms:
- Species: Anolis carolinensis
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: -A_carolinensis
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 24 | 64 |
PFAM A | TNFR_c6 | 66 | 104 |
Protein sequence [+]
| Anolis carolinensis | 28377 | length:218
MCRAGTYVEEACTIPHTLGHCSPCTNGEDYTEHESGLNQCFPCEKCKPGYVMVKACTATS
NTKCQCPEGYYCPPGCEECVKCRKRCPKGEVQVKSCSSTTDMECSPSSTGTTDSAHPMGI
IITVVFSVIGIGIVIMIAILFKFRKRNSLSTLERVKESKSLISVNSDAPNTNPEMPGLRN
KGSQNEESSNLMVGSTSEGSDPRKAPSAPMLQQSENPA
NTKCQCPEGYYCPPGCEECVKCRKRCPKGEVQVKSCSSTTDMECSPSSTGTTDSAHPMGI
IITVVFSVIGIGIVIMIAILFKFRKRNSLSTLERVKESKSLISVNSDAPNTNPEMPGLRN
KGSQNEESSNLMVGSTSEGSDPRKAPSAPMLQQSENPA
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0009055 | electron carrier activity | mollecular_function | IEA |
GO:0051536 | iron-sulfur cluster binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSACAG00000000072
- Expression info from Arrayexpress [?] : ENSACAG00000000072
- Protein expression from Protein Atlas: [?] ENSACAG00000000072
Click on [?] for more information.