TNFSF13 (Anolis carolinensis)
Description [+]
- Synonyms: TNFSF13
- Species: Anolis carolinensis
- Short gene description: Tumor necrosis factor ligand superfamily member 13 Precursor (A proliferation-inducing ligand)(APRIL)(TNF- and APOL-related leukocyte expressed ligand 2)(TALL-2)(TNF-related death ligand 1)(TRDL-1)(CD256 antigen) [Source:UniProtKB/Swiss-Prot;Acc:O75888]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFSF13-A_carolinensis
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 5 | 122 |
PFAM A | TNF | 170 | 285 |
Protein sequence [+]
TNFSF13 | Anolis carolinensis | 28377 | length:285
NGTIHGWAEAKLNTTSPLRYDRGRREFTVVKRGLYYLYCQVHFNEGKTIYMKLDVMLDGE
LALRCLEQFPPTSSGPQEPELKVCQVSGLVLLTPGESIRLRTIPKVRLKAERYLTYFGLF
QPDWRVAWRREGTISCSHHPRIIDKMKINNYVGQLILADPQGNEENETEIWWEPFLQQGR
ALELRGRDVVVKQKGLYFVYSQVLFHDPTFTMGQVLWRMAVGRPDQILFRCVQSMPAHPG
KAYNSCYSGGIFHLQHGDRLNLRIPRFNASFDVSAHGTFLGLLRL
LALRCLEQFPPTSSGPQEPELKVCQVSGLVLLTPGESIRLRTIPKVRLKAERYLTYFGLF
QPDWRVAWRREGTISCSHHPRIIDKMKINNYVGQLILADPQGNEENETEIWWEPFLQQGR
ALELRGRDVVVKQKGLYFVYSQVLFHDPTFTMGQVLWRMAVGRPDQILFRCVQSMPAHPG
KAYNSCYSGGIFHLQHGDRLNLRIPRFNASFDVSAHGTFLGLLRL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0008219 | cell death | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0050776 | regulation of immune response | biological_proccess | IEA |
GO:0002426 | immunoglobulin production in mucosal tissue | biological_proccess | IEA |
GO:0002636 | positive regulation of germinal center formation | biological_proccess | IEA |
GO:0016064 | immunoglobulin mediated immune response | biological_proccess | IEA |
GO:0048298 | positive regulation of isotype switching to IgA isotypes | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSACAG00000014779
- Expression info from Arrayexpress [?] : ENSACAG00000014779
- Protein expression from Protein Atlas: [?] ENSACAG00000014779
Click on [?] for more information.