NP_001014404.1 (Bos taurus)
Description [+]
- Synonyms: NP_001014404.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: myeloid differentiation primary response gene 88 [Source:RefSeq peptide;Acc:NP_001014404]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001014404.1-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Death | 31 | 109 |
PFAM A | TIR | 163 | 292 |
Protein sequence [+]
NP_001014404.1 | Bos taurus | 9913 | length:296
MAEGVPRAGSALPAASLSSLPLAALNVRVRRRLSLFLNVRAPVAADWTVLAEAMDFEYLE
IQQLEKYADPTSRLLDDWQRRPGASVGRLLELLAKLGRDDVLMELGPSIEEDCQKYILKQ
QQEASEKPLQVDSIDSSITRINDMAGITIRDDPLGQKPECFDAFICYCPSDIEFVHEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDEYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKPMKKEFPSILRFITVCDYTNPCTQNWFWTRLAKALSMP
IQQLEKYADPTSRLLDDWQRRPGASVGRLLELLAKLGRDDVLMELGPSIEEDCQKYILKQ
QQEASEKPLQVDSIDSSITRINDMAGITIRDDPLGQKPECFDAFICYCPSDIEFVHEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDEYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKPMKKEFPSILRFITVCDYTNPCTQNWFWTRLAKALSMP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0032760 | positive regulation of tumor necrosis factor production | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0009615 | response to virus | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0045080 | positive regulation of chemokine biosynthetic process | biological_proccess | IEA |
GO:0016064 | immunoglobulin mediated immune response | biological_proccess | IEA |
GO:0002238 | response to molecule of fungal origin | biological_proccess | IEA |
GO:0002755 | MyD88-dependent toll-like receptor signaling pathway | biological_proccess | IEA |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0045351 | type I interferon biosynthetic process | biological_proccess | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0031224 | intrinsic to membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000000563
- Expression info from Arrayexpress [?] : ENSBTAG00000000563
- Protein expression from Protein Atlas: [?] ENSBTAG00000000563
- entrezgene: 444881
- refseq_dna: NM_001014382
- refseq_peptide: NP_001014404
Click on [?] for more information.