GBRAP_BOVIN (Bos taurus)
Description [+]
- Synonyms: GBRAP_BOVIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) [Source:UniProtKB/Swiss-Prot;Acc:Q9GJW7]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: GBRAP_BOVIN-B_taurus
Structure & Sequence [+]
Protein sequence [+]
GBRAP_BOVIN | Bos taurus | 9913 | length:117
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0015031 | protein transport | biological_proccess | IEA |
GO:0000045 | autophagic vacuole formation | biological_proccess | IEA |
GO:0000226 | microtubule cytoskeleton organization | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0048487 | beta-tubulin binding | mollecular_function | IEA |
GO:0050811 | GABA receptor binding | mollecular_function | IEA |
GO:0008017 | microtubule binding | mollecular_function | IEA |
GO:0012505 | endomembrane system | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005874 | microtubule | cell_component | IEA |
GO:0005856 | cytoskeleton | cell_component | IEA |
GO:0005794 | Golgi apparatus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0000421 | autophagic vacuole membrane | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0005764 | lysosome | cell_component | IEA |
GO:0015629 | actin cytoskeleton | cell_component | IEA |
GO:0005790 | smooth endoplasmic reticulum | cell_component | IEA |
GO:0005875 | microtubule associated complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000014883
- Expression info from Arrayexpress [?] : ENSBTAG00000014883
- Protein expression from Protein Atlas: [?] ENSBTAG00000014883
Click on [?] for more information.