IPI00700517.4 (Bos taurus)
Description [+]
- Synonyms: IPI00700517.4
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: IPI00700517.4-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53 | 1 | 166 |
PFAM A | P53_tetramer | 198 | 239 |
PFAM A | SAM_2 | 348 | 414 |
Protein sequence [+]
IPI00700517.4 | Bos taurus | 9913 | length:492
YSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREF
NEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV
GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDG
TKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIE
TYRQQQQQQHQHLLQKQTSMQSQSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPT
TIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSLVSFL
ARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHDFSSP
PHLLRTPSGASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQ
RIKEEGEEGEIR
NEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV
GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDG
TKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIE
TYRQQQQQQHQHLLQKQTSMQSQSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPT
TIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSLVSFL
ARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHDFSSP
PHLLRTPSGASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQ
RIKEEGEEGEIR
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0002347 | response to tumor cell | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0045892 | negative regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045747 | positive regulation of Notch signaling pathway | biological_proccess | IEA |
GO:0051289 | protein homotetramerization | biological_proccess | IEA |
GO:0030154 | cell differentiation | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0001501 | skeletal system development | biological_proccess | IEA |
GO:0002064 | epithelial cell development | biological_proccess | IEA |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IEA |
GO:0030326 | embryonic limb morphogenesis | biological_proccess | IEA |
GO:0030855 | epithelial cell differentiation | biological_proccess | IEA |
GO:0001942 | hair follicle development | biological_proccess | IEA |
GO:0042475 | odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0009954 | proximal/distal pattern formation | biological_proccess | IEA |
GO:0048745 | smooth muscle development | biological_proccess | IEA |
GO:0051402 | neuron apoptosis | biological_proccess | IEA |
GO:0008544 | epidermis development | biological_proccess | IEA |
GO:0001736 | establishment of planar polarity | biological_proccess | IEA |
GO:0002053 | positive regulation of mesenchymal cell proliferation | biological_proccess | IEA |
GO:0007389 | pattern specification process | biological_proccess | IEA |
GO:0007499 | ectoderm and mesoderm interaction | biological_proccess | IEA |
GO:0007569 | cell aging | biological_proccess | IEA |
GO:0010259 | multicellular organismal aging | biological_proccess | IEA |
GO:0030850 | prostate gland development | biological_proccess | IEA |
GO:0030859 | polarized epithelial cell differentiation | biological_proccess | IEA |
GO:0035121 | tail morphogenesis | biological_proccess | IEA |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IEA |
GO:0043589 | skin morphogenesis | biological_proccess | IEA |
GO:0043616 | keratinocyte proliferation | biological_proccess | IEA |
GO:0045617 | negative regulation of keratinocyte differentiation | biological_proccess | IEA |
GO:0048485 | sympathetic nervous system development | biological_proccess | IEA |
GO:0048646 | anatomical structure formation involved in morphogenesis | biological_proccess | IEA |
GO:0048807 | female genitalia morphogenesis | biological_proccess | IEA |
GO:0060157 | urinary bladder development | biological_proccess | IEA |
GO:0060197 | cloacal septation | biological_proccess | IEA |
GO:0030216 | keratinocyte differentiation | biological_proccess | IEA |
GO:0001738 | morphogenesis of a polarized epithelium | biological_proccess | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0016563 | transcription activator activity | mollecular_function | IEA |
GO:0016564 | transcription repressor activity | mollecular_function | IEA |
GO:0043565 | sequence-specific DNA binding | mollecular_function | IEA |
GO:0003684 | damaged DNA binding | mollecular_function | IEA |
GO:0003682 | chromatin binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000015460
- Expression info from Arrayexpress [?] : ENSBTAG00000015460
- Protein expression from Protein Atlas: [?] ENSBTAG00000015460
- entrezgene: 615335
Click on [?] for more information.