BNIP3_BOVIN (Bos taurus)
Description [+]
- Synonyms: BNIP3_BOVIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q32KN2]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BNIP3_BOVIN-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BNIP3 | 1 | 196 |
Protein sequence [+]
BNIP3_BOVIN | Bos taurus | 9913 | length:196
MQESEKPGPQAESPSGSWVELHFGSNGNGSSVPDSVSIYNGDMEKILLDAQHESGRSSSK
SSHCDSPPRSQTPQDTNRASETDTHSLGEKNSSQSEEDYMERRKEVESILKKNSDWIWDW
SSRPENVPPAKEFLLFKHPKRTPTLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIG
LGIYIGRRLTTSTSTF
SSHCDSPPRSQTPQDTNRASETDTHSLGEKNSSQSEEDYMERRKEVESILKKNSDWIWDW
SSRPENVPPAKEFLLFKHPKRTPTLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIG
LGIYIGRRLTTSTSTF
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0050873 | brown fat cell differentiation | biological_proccess | IEA |
GO:0005740 | mitochondrial envelope | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000017804
- Expression info from Arrayexpress [?] : ENSBTAG00000017804
- Protein expression from Protein Atlas: [?] ENSBTAG00000017804
- entrezgene: 615342
- refseq_dna: NM_001076366
- refseq_peptide: NP_001069834
Click on [?] for more information.