NP_001095644.1 (Bos taurus)
Description [+]
- Synonyms: NP_001095644.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: mitogen-activated protein kinase 14 [Source:RefSeq peptide;Acc:NP_001095644]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001095644.1-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 24 | 308 |
PFAM A | Pkinase_Tyr | 24 | 250 |
Protein sequence [+]
NP_001095644.1 | Bos taurus | 9913 | length:360
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0006950 | response to stress | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0001525 | angiogenesis | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0000902 | cell morphogenesis | biological_proccess | IEA |
GO:0007243 | protein kinase cascade | biological_proccess | IEA |
GO:0019395 | fatty acid oxidation | biological_proccess | IEA |
GO:0045648 | positive regulation of erythrocyte differentiation | biological_proccess | IEA |
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0007519 | skeletal muscle development | biological_proccess | IEA |
GO:0000077 | DNA damage checkpoint | biological_proccess | IEA |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0032495 | response to muramyl dipeptide | biological_proccess | IEA |
GO:0002062 | chondrocyte differentiation | biological_proccess | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0000922 | spindle pole | cell_component | IEA |
GO:0005623 | cell | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000020783
- Expression info from Arrayexpress [?] : ENSBTAG00000020783
- Protein expression from Protein Atlas: [?] ENSBTAG00000020783
- entrezgene: 534492
- refseq_dna: NM_001102174
- refseq_peptide: NP_001095644
Click on [?] for more information.