KCY_BOVIN (Bos taurus)
Description [+]
- Synonyms: KCY_BOVIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: UMP-CMP kinase (EC 2.7.4.14)(Cytidylate kinase)(Deoxycytidylate kinase)(Cytidine monophosphate kinase)(Uridine monophosphate kinase)(Uridine monophosphate/cytidine monophosphate kinase)(UMP/CMP kinase)(UMP/CMPK) [Source:UniProtKB/Swiss-Prot;Acc:Q2KIW9]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: KCY_BOVIN-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 40 | 203 |
Protein sequence [+]
KCY_BOVIN | Bos taurus | 9913 | length:228
MLNRCGRRLLHVLGLSFPLLTGRPLFLFPHRFMKPQVVFVLGGPGAGKGTQCARIVEKYG
YTHLSAGELLRDERKNPDSQYGELIEKYIKDGKIVPVEITISLLRREMDQTMAANAQKNK
FLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESL
EKRIQTYLQSTKPIIDLYEEMGKVRKIDASKSVDEVFDEVVKIFDKEG
YTHLSAGELLRDERKNPDSQYGELIEKYIKDGKIVPVEITISLLRREMDQTMAANAQKNK
FLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESL
EKRIQTYLQSTKPIIDLYEEMGKVRKIDASKSVDEVFDEVVKIFDKEG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0006810 | transport | biological_proccess | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0005215 | transporter activity | mollecular_function | IEA |
GO:0005488 | binding | mollecular_function | IEA |
GO:0016776 | phosphotransferase activity, phosphate group as acceptor | mollecular_function | IEA |
GO:0019201 | nucleotide kinase activity | mollecular_function | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000019956
- Expression info from Arrayexpress [?] : ENSBTAG00000019956
- Protein expression from Protein Atlas: [?] ENSBTAG00000019956
- entrezgene: 509965
- refseq_dna: NM_001046044
- refseq_peptide: NP_001039509
Click on [?] for more information.