NP_001035051.1 (Bos taurus)
Description [+]
- Synonyms: NP_001035051.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: Toll-interleukin 1 receptor domain-containing adaptor protein [Source:RefSeq peptide;Acc:NP_001035051]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001035051.1-B_taurus
Structure & Sequence [+]
Protein sequence [+]
NP_001035051.1 | Bos taurus | 9913 | length:232
MASSTSSPAPGSRSKKPLGKMADWFRQALARKPTKMPVSPESALSDVSHPSSPDSPPSLG
SSSEVSPIPAPSHGSADGGGGSGNSGNSSGGRWSKDYDVCVCHSEEDLAAAQELVSYLEG
GAASLRCFLQLRDATPGGAIVSELCHALSSSHCRVLLITPGFLRDPWCRYQMLQALSEAP
GAEGRTIPLMSGLSRAAYPAELRYMYFVDGRGPEGGFRQVKEAVMRYLQTLG
SSSEVSPIPAPSHGSADGGGGSGNSGNSSGGRWSKDYDVCVCHSEEDLAAAQELVSYLEG
GAASLRCFLQLRDATPGGAIVSELCHALSSSHCRVLLITPGFLRDPWCRYQMLQALSEAP
GAEGRTIPLMSGLSRAAYPAELRYMYFVDGRGPEGGFRQVKEAVMRYLQTLG
Structure links:
- Smartdomain prediction information: SM00255
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007249 | I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0030099 | myeloid cell differentiation | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0031224 | intrinsic to membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000021504
- Expression info from Arrayexpress [?] : ENSBTAG00000021504
- Protein expression from Protein Atlas: [?] ENSBTAG00000021504
- entrezgene: 531079
- refseq_dna: NM_001039962
- refseq_peptide: NP_001035051
Click on [?] for more information.