ZK673.2 (Caenorhabditis elegans)
Description [+]
- Synonyms: ZK673.2
- Species: Metazoa;Bilateria;Ecdysozoa;Nematoda; Caenorhabditis elegans
- Short gene description: Probable adenylate kinase isoenzyme ZK673.2 (EC 2.7.4.3) (ATP-AMP transphosphorylase). [Source:UniProtKB/Swiss-Prot;Acc:Q09629]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: ZK673.2-C_elegans
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | ADK | 6 | 188 |
| PFAM A | ADK_lid | 125 | 160 |
Protein sequence [+]
ZK673.2 | Caenorhabditis elegans | 6239 | length:222
MYRVLLSGAAGSGKGTIARMLVREFEPLGFNYFAAGDFIRDHIARGTEFGVRAQSFLNKG
EHVPDSILNGAILAEMLKAGPRVVLDGYPRNMSQLKMVEEQAPLNLIVELKVPRKVLIDR
LSKQLVHPASGRAYNLEVNPPKEEGKDDITGEPLFKRSTDQLEVARRRLEVYDKTENKVL
DYYKKQNKCITMSGESSKAVFESVAEVMRRDLLTTTPRTAYA
EHVPDSILNGAILAEMLKAGPRVVLDGYPRNMSQLKMVEEQAPLNLIVELKVPRKVLIDR
LSKQLVHPASGRAYNLEVNPPKEEGKDDITGEPLFKRSTDQLEVARRRLEVYDKTENKVL
DYYKKQNKCITMSGESSKAVFESVAEVMRRDLLTTTPRTAYA
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
| GO:0043254 | regulation of protein complex assembly | biological_proccess | IEA |
| GO:0008134 | transcription factor binding | mollecular_function | IEA |
| GO:0000166 | nucleotide binding | mollecular_function | IEA |
| GO:0017111 | nucleoside-triphosphatase activity | mollecular_function | IEA |
| GO:0005622 | intracellular | cell_component | IEA |
| GO:0005634 | nucleus | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
