AK3 (Canis lupus familiaris)
Description [+]
- Synonyms: AK3
- Species: Canis lupus familiaris
- Short gene description: GTP:AMP phosphotransferase mitochondrial (EC 2.7.4.10)(Adenylate kinase 3)(AK 3)(Adenylate kinase 3 alpha-like 1) [Source:UniProtKB/Swiss-Prot;Acc:Q9UIJ7]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: AK3-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 12 | 192 |
PFAM A | ADK_lid | 128 | 163 |
Protein sequence [+]
AK3 | Canis lupus familiaris | 9615 | length:227
MGASVRLLRAVLMGPPGSGKRTVALRITKGFQLKTFSSGDLLRDNLLRDTEIGVLAKVFM
DQGKLIPDDIMTRLTLHQLKTFTQESWLLCGFPRTLPQAEALERAYQIHLVMSLNVPSEV
IKQRLSARWIHPSSGRVYNLEFNPPKAIGLDDLTGEPLVQREDDRPETLNQRLKAYEDQT
KPVLEYYREKGVLETFSGTKTDQIWPCVRAFLQTKVPQIDQKASVTP
DQGKLIPDDIMTRLTLHQLKTFTQESWLLCGFPRTLPQAEALERAYQIHLVMSLNVPSEV
IKQRLSARWIHPSSGRVYNLEFNPPKAIGLDDLTGEPLVQREDDRPETLNQRLKAYEDQT
KPVLEYYREKGVLETFSGTKTDQIWPCVRAFLQTKVPQIDQKASVTP
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0004765 | shikimate kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0016776 | phosphotransferase activity, phosphate group as acceptor | mollecular_function | IEA |
GO:0019201 | nucleotide kinase activity | mollecular_function | IEA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000000211
- Expression info from Arrayexpress [?] : ENSCAFG00000000211
- Protein expression from Protein Atlas: [?] ENSCAFG00000000211
- entrezgene: 481438
Click on [?] for more information.