CYC_CANFA (Canis lupus familiaris)
Description [+]
- Synonyms: CYC_CANFA
- Species: Canis lupus familiaris
- Short gene description: Cytochrome c. [Source:UniProtKB/Swiss-Prot;Acc:P00011]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CYC_CANFA-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Cytochrom_C | 4 | 103 |
Protein sequence [+]
CYC_CANFA | Canis lupus familiaris | 9615 | length:105
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE
GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | ISS |
GO:0006810 | transport | biological_proccess | IEA |
GO:0022900 | electron transport chain | biological_proccess | IEA |
GO:0005506 | iron ion binding | mollecular_function | IEA |
GO:0009055 | electron carrier activity | mollecular_function | IEA |
GO:0020037 | heme binding | mollecular_function | IEA |
GO:0045155 | electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity | mollecular_function | ISS |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005759 | mitochondrial matrix | cell_component | IEA |
GO:0005829 | cytosol | cell_component | ISS |
GO:0070469 | respiratory chain | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000002856
- Expression info from Arrayexpress [?] : ENSCAFG00000002856
- Protein expression from Protein Atlas: [?] ENSCAFG00000002856
- entrezgene: 475258
Click on [?] for more information.