BIRC5_CANFA (Canis lupus familiaris)
Description [+]
- Synonyms: BIRC5_CANFA
- Species: Canis lupus familiaris
- Short gene description: Baculoviral IAP repeat-containing protein 5 (Apoptosis inhibitor survivin) [Source:UniProtKB/Swiss-Prot;Acc:Q8I009]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BIRC5_CANFA-C_familiaris
Structure & Sequence [+]
Protein sequence [+]
BIRC5_CANFA | Canis lupus familiaris | 9615 | length:142
MGASSLPPAWQLYLKDHRVSTFKNWPFLEGCACTPDRMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERAKNKIAKETNNK
QKEFEETAKKVRCAIEQLAAAE
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERAKNKIAKETNNK
QKEFEETAKKVRCAIEQLAAAE
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000086 | G2/M transition of mitotic cell cycle | biological_proccess | ISS |
GO:0000910 | cytokinesis | biological_proccess | ISS |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | ISS |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0007067 | mitosis | biological_proccess | IEA |
GO:0031503 | protein complex localization | biological_proccess | IEA |
GO:0031536 | positive regulation of exit from mitosis | biological_proccess | ISS |
GO:0031577 | spindle checkpoint | biological_proccess | ISS |
GO:0043154 | negative regulation of caspase activity | biological_proccess | ISS |
GO:0045931 | positive regulation of mitotic cell cycle | biological_proccess | ISS |
GO:0051301 | cell division | biological_proccess | IEA |
GO:0051303 | establishment of chromosome localization | biological_proccess | ISS |
GO:0009790 | embryonic development | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0000226 | microtubule cytoskeleton organization | biological_proccess | IEA |
GO:0004866 | endopeptidase inhibitor activity | mollecular_function | IEA |
GO:0004869 | cysteine-type endopeptidase inhibitor activity | mollecular_function | IEA |
GO:0008017 | microtubule binding | mollecular_function | ISS |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0015631 | tubulin binding | mollecular_function | ISS |
GO:0042803 | protein homodimerization activity | mollecular_function | ISS |
GO:0043027 | caspase inhibitor activity | mollecular_function | ISS |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0048037 | cofactor binding | mollecular_function | ISS |
GO:0051087 | chaperone binding | mollecular_function | IEA |
GO:0000775 | chromosome, centromeric region | cell_component | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005694 | chromosome | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005814 | centriole | cell_component | ISS |
GO:0005829 | cytosol | cell_component | ISS |
GO:0005876 | spindle microtubule | cell_component | ISS |
GO:0005881 | cytoplasmic microtubule | cell_component | ISS |
GO:0030496 | midbody | cell_component | ISS |
GO:0031021 | interphase microtubule organizing center | cell_component | ISS |
GO:0043234 | protein complex | cell_component | ISS |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000005302
- Expression info from Arrayexpress [?] : ENSCAFG00000005302
- Protein expression from Protein Atlas: [?] ENSCAFG00000005302
Click on [?] for more information.