BCL2L11 (Canis lupus familiaris)
Description [+]
- Synonyms: BCL2L11
- Species: Canis lupus familiaris
- Short gene description: Bcl-2-like protein 11 (Bcl2-interacting mediator of cell death) [Source:UniProtKB/Swiss-Prot;Acc:O43521]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BCL2L11-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bim_N | 4 | 40 |
PFAM A | Bclx_interact | 127 | 165 |
Protein sequence [+]
BCL2L11 | Canis lupus familiaris | 9615 | length:196
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPL
APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
NHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMI
ILRLLRYIVRLVWRLQ
APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
NHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMI
ILRLLRYIVRLVWRLQ
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0051258 | protein polymerization | biological_proccess | IEA |
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0001701 | in utero embryonic development | biological_proccess | IEA |
GO:0030879 | mammary gland development | biological_proccess | IEA |
GO:0007283 | spermatogenesis | biological_proccess | IEA |
GO:0009791 | post-embryonic development | biological_proccess | IEA |
GO:0048066 | pigmentation during development | biological_proccess | IEA |
GO:0048536 | spleen development | biological_proccess | IEA |
GO:0048538 | thymus development | biological_proccess | IEA |
GO:0001822 | kidney development | biological_proccess | IEA |
GO:0007160 | cell-matrix adhesion | biological_proccess | IEA |
GO:0042475 | odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0008584 | male gonad development | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0002262 | myeloid cell homeostasis | biological_proccess | IEA |
GO:0043583 | ear development | biological_proccess | IEA |
GO:0048070 | regulation of pigmentation during development | biological_proccess | IEA |
GO:0001783 | B cell apoptosis | biological_proccess | IEA |
GO:0046620 | regulation of organ growth | biological_proccess | IEA |
GO:0048563 | post-embryonic organ morphogenesis | biological_proccess | IEA |
GO:0035148 | lumen formation | biological_proccess | IEA |
GO:0001776 | leukocyte homeostasis | biological_proccess | IEA |
GO:0002260 | lymphocyte homeostasis | biological_proccess | IEA |
GO:0003924 | GTPase activity | mollecular_function | IEA |
GO:0005525 | GTP binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008017 | microtubule binding | mollecular_function | IEA |
GO:0043234 | protein complex | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0000300 | peripheral to membrane of membrane fraction | cell_component | IEA |
GO:0043231 | intracellular membrane-bounded organelle | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000007090
- Expression info from Arrayexpress [?] : ENSCAFG00000007090
- Protein expression from Protein Atlas: [?] ENSCAFG00000007090
- entrezgene: 612867
Click on [?] for more information.