CD27 (Canis lupus familiaris)
Description [+]
- Synonyms: CD27
- Species: Canis lupus familiaris
- Short gene description: CD27 antigen Precursor (CD27L receptor)(T-cell activation antigen CD27)(T14)(Tumor necrosis factor receptor superfamily member 7)(CD27 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P26842]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD27-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 27 | 62 |
PFAM A | TNFR_c6 | 65 | 104 |
Protein sequence [+]
CD27 | Canis lupus familiaris | 9615 | length:260
MARPPPCWLWILGTLAGLSATPAPKRCPEKHYQVQGERCCQMCKPGTFLVKDCERHGEAA
QCDPCIPGASFSPDHHARRHCESCRHCNSGLLIRNCTLTANAECDCPKGWKCRDKQCTEC
DPPSNPLLIPHPSPARGPHLQPTHLPYAKKMQETSTVRQVQTLADFRWLPAPALSTHWPP
QRSLCSSDCIRIFVILSGMFLAFTMIGALFFHQQRKYRLNKEEYPVVPVEPCPYSCPREE
EGGAIPIQEDYRKPEPASYC
QCDPCIPGASFSPDHHARRHCESCRHCNSGLLIRNCTLTANAECDCPKGWKCRDKQCTEC
DPPSNPLLIPHPSPARGPHLQPTHLPYAKKMQETSTVRQVQTLADFRWLPAPALSTHWPP
QRSLCSSDCIRIFVILSGMFLAFTMIGALFFHQQRKYRLNKEEYPVVPVEPCPYSCPREE
EGGAIPIQEDYRKPEPASYC
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0043027 | caspase inhibitor activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000015149
- Expression info from Arrayexpress [?] : ENSCAFG00000015149
- Protein expression from Protein Atlas: [?] ENSCAFG00000015149
- entrezgene: 611674
Click on [?] for more information.