TRADD (Canis lupus familiaris)
Description [+]
- Synonyms: TRADD
- Species: Canis lupus familiaris
- Short gene description: Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein)(TNFRSF1A-associated via death domain) [Source:UniProtKB/Swiss-Prot;Acc:Q15628]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TRADD-C_familiaris
Structure & Sequence [+]
Protein sequence [+]
TRADD | Canis lupus familiaris | 9615 | length:312
MATGPDGLEEWVGSAYLFVESSLDKVVLSDAYAQAQQKVPVYRALRTALAESGGSPDVLQ
MLKIHRSEPQLIVQLRFCGRQPCSRFLRAYREGSLRAALQACLAAALAQRSMPLQLELRA
GAERLDTLLTDEERCLSCIFAQKPDRLRDEELSELEDALQNLTCGSGRQDGDVEVAPAPS
QSLATSLSEEKPPPPPPPGQTFLFQGQPIVNRPLSLQDQQKFARSVGLKWRKVGRSLQRG
CRALKDPALDSLAYEYEREGLYEQAFQLLKRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTNPDGSLA
MLKIHRSEPQLIVQLRFCGRQPCSRFLRAYREGSLRAALQACLAAALAQRSMPLQLELRA
GAERLDTLLTDEERCLSCIFAQKPDRLRDEELSELEDALQNLTCGSGRQDGDVEVAPAPS
QSLATSLSEEKPPPPPPPGQTFLFQGQPIVNRPLSLQDQQKFARSVGLKWRKVGRSLQRG
CRALKDPALDSLAYEYEREGLYEQAFQLLKRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTNPDGSLA
Structure links:
- Smartdomain prediction information: SM00005
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0051798 | positive regulation of hair follicle development | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004871 | signal transducer activity | mollecular_function | IEA |
GO:0070513 | death domain binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0019900 | kinase binding | mollecular_function | IEA |
GO:0060090 | molecular adaptor activity | mollecular_function | IEA |
GO:0019215 | intermediate filament binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0043235 | receptor complex | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000020382
- Expression info from Arrayexpress [?] : ENSCAFG00000020382
- Protein expression from Protein Atlas: [?] ENSCAFG00000020382
- entrezgene: 611262
Click on [?] for more information.