Q6JDN3_CANFA (Canis lupus familiaris)
Description [+]
- Synonyms: Q6JDN3_CANFA
- Species: Canis lupus familiaris
- Short gene description: Annexin I Fragment [Source:UniProtKB/TrEMBL;Acc:Q6JDN3]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q6JDN3_CANFA-C_familiaris
Structure & Sequence [+]
Protein sequence [+]
Q6JDN3_CANFA | Canis lupus familiaris | 9615 | length:345
MAMVSEFLKQAWFIENEEQEYIETVKGSKGGPGSAVSPYPSFNPSSDVAALHNAITVKGV
DEATIIDILTKRNNAQRQQIKAAYLQEKGKPLDEALKKALSGHLEEVVLALLKTPAQFDA
DELRGAMKGLGTDEDTLDEILASRTNKEIREINRVYREELKRDLAKDITSDTSGDYRNAL
LSLAKGDRSEDFGVNDDLADTDARALYEAGERRKGTDVNVFITILTTRAYPHLRQVFQKY
RKYSKHDMNKVLDLEMKGDIEKCLTAIVKCATSKPMFFAEKLHEAMKGSGTRHKTLIRIM
VSRSEIDMNDIKACYQKLYGVSLCQAILDETKGDYEKILVALCGD
DEATIIDILTKRNNAQRQQIKAAYLQEKGKPLDEALKKALSGHLEEVVLALLKTPAQFDA
DELRGAMKGLGTDEDTLDEILASRTNKEIREINRVYREELKRDLAKDITSDTSGDYRNAL
LSLAKGDRSEDFGVNDDLADTDARALYEAGERRKGTDVNVFITILTTRAYPHLRQVFQKY
RKYSKHDMNKVLDLEMKGDIEKCLTAIVKCATSKPMFFAEKLHEAMKGSGTRHKTLIRIM
VSRSEIDMNDIKACYQKLYGVSLCQAILDETKGDYEKILVALCGD
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0018149 | peptide cross-linking | biological_proccess | IEA |
GO:0030216 | keratinocyte differentiation | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0050482 | arachidonic acid secretion | biological_proccess | IEA |
GO:0050819 | negative regulation of coagulation | biological_proccess | IEA |
GO:0007010 | cytoskeleton organization | biological_proccess | IEA |
GO:0005198 | structural molecule activity | mollecular_function | IEA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005544 | calcium-dependent phospholipid binding | mollecular_function | IEA |
GO:0030674 | protein binding, bridging | mollecular_function | IEA |
GO:0004859 | phospholipase inhibitor activity | mollecular_function | IEA |
GO:0008092 | cytoskeletal protein binding | mollecular_function | IEA |
GO:0001533 | cornified envelope | cell_component | IEA |
GO:0042383 | sarcolemma | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000001778
- Expression info from Arrayexpress [?] : ENSCAFG00000001778
- Protein expression from Protein Atlas: [?] ENSCAFG00000001778
Click on [?] for more information.