RPR (Drosophila melanogaster)
Description [+]
- Synonyms: RPR, CELL DEATH PROTEIN RPR, REAPER
- Species: Metazoa;Bilateria;Ecdysozoa;Arthropoda;Hexapoda; Drosophila melanogaster
- Short gene description: NA
- Family: IAP antagonist
- Process: apoptosis,
- Pathways:
- Criteria: manually curated
- Curator comment:
- WIKI: RPR-D_melanogaster
References [+]
- Genetic control of programmed cell death in Drosophila.
- White K, Grether ME, Abrams JM, Young L, Farrell K, Steller H
- A gene, reaper (rpr), that appears to play a central control function for the initiation of programmed cell death (apoptosis) in Drosophila was identified. Virtually all programmed cell death that normally occurs during Drosophila embryogenesis was blocked in embryos homozygous for a small deletion that includes the reaper gene. Mutant embryos contained many extra cells and failed to hatch, but many other aspects of development appeared quite normal. Deletions that include reaper also protected embryos from apoptosis caused by x-irradiation and developmental defects. However, high doses of x-rays induced some apoptosis in mutant embryos, and the resulting corpses were phagocytosed by macrophages. These data suggest that the basic cell death program is intact although it was not activated in mutant embryos. The DNA encompassed by the deletion was cloned and the reaper gene was identified on the basis of the ability of cloned DNA to restore apoptosis to cell death defective embryos in germ line transformation experiments. The reaper gene appears to encode a small peptide that shows no homology to known proteins, and reaper messenger RNA is expressed in cells destined to undergo apoptosis. Science. 1994 Apr 29;264(5159):677-83.
Structure & Sequence [+]
Protein sequence [+]
rpr | Drosophila melanogaster | 7227 | length:65
MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLETLRQYTSCHPKTGRKSGKY
RKPSQ
RKPSQ
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007156 | homophilic cell adhesion | biological_proccess | IEA |
GO:0007424 | open tracheal system development | biological_proccess | IGI |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0031177 | phosphopantetheine binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
miRNAs [+]
miRNA | Regulation | Description | Pubmed |
---|---|---|---|
dme-miR-13b | downregulation by 2’-O-Me antisense miRNA oligon | The rpr luciferase sensor shows strong deredeath pression in miR-6 and 2/13, moderate derepression in miR-11, and no significant effect in miR-308 depleted embryos (Figure 7M). | Ref. |
dme-miR-13b | downregulation by 2’-O-Me antisense miRNA oligon | The rpr luciferase sensor shows strong deredeath pression in miR-6 and 2/13, moderate derepression in miR-11, and no significant effect in miR-308 depleted embryos (Figure 7M). | Ref. |
dme-miR-2a | Ref. | ||
dme-miR-2b | downregulation by 2’-O-Me antisense miRNA oligon | The rpr luciferase sensor shows strong deredeath pression in miR-6 and 2/13, moderate derepression in miR-11, and no significant effect in miR-308 depleted embryos (Figure 7M). | Ref. |
dme-miR-2b | downregulation by 2’-O-Me antisense miRNA oligon | The rpr luciferase sensor shows strong deredeath pression in miR-6 and 2/13, moderate derepression in miR-11, and no significant effect in miR-308 depleted embryos (Figure 7M). | Ref. |
dme-miR-6 | downregulation by 2’-O-Me antisense miRNA oligon | The rpr luciferase sensor shows strong deredeath pression in miR-6 and 2/13, moderate derepression in miR-11, and no significant effect in miR-308 depleted embryos (Figure 7M). | Ref. |
dme-miR-6 | downregulation by 2’-O-Me antisense miRNA oligon | The rpr luciferase sensor shows strong deredeath pression in miR-6 and 2/13, moderate derepression in miR-11, and no significant effect in miR-308 depleted embryos (Figure 7M). | Ref. |
Information from other databases [+]
- Gene info from FyBase [?] FBgn0011706
- Ensembl genome browser [?] : FBgn0011706
- Expression info from Arrayexpress [?] : FBgn0011706
- Protein expression from Protein Atlas: [?] FBgn0011706
Click on [?] for more information.