ADK1 (Drosophila melanogaster)
Description [+]
- Synonyms: ADK1
- Species: Metazoa;Bilateria;Ecdysozoa;Arthropoda;Hexapoda; Drosophila melanogaster
- Short gene description: NA
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: ADK1-D_melanogaster
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | ADK | 37 | 195 |
Protein sequence [+]
Adk1 | Drosophila melanogaster | 7227 | length:229
MLFMCHQRVMKKEAEEKLKAEELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTH
LSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYP
RQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFK
QNTNAILELYEPKTLTINAERDVDDIFLEVVQAIDCVLKKKQQNAAAQC
LSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYP
RQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFK
QNTNAILELYEPKTLTINAERDVDDIFLEVVQAIDCVLKKKQQNAAAQC
Structure links:
- Prosite motif and domain information: PS00113
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006979 | response to oxidative stress | biological_proccess | IEA |
| GO:0055114 | oxidation reduction | biological_proccess | IEA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0004601 | peroxidase activity | mollecular_function | IEA |
| GO:0020037 | heme binding | mollecular_function | IEA |
| GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from FyBase [?] FBgn0022709
- Ensembl genome browser [?] : FBgn0022709
- Expression info from Arrayexpress [?] : FBgn0022709
- Protein expression from Protein Atlas: [?] FBgn0022709
Click on [?] for more information.
