ARD1 (Drosophila melanogaster)
Description [+]
- Synonyms: ARD1, ARREST DEFECTIVE 1
- Species: Metazoa;Bilateria;Ecdysozoa;Arthropoda;Hexapoda; Drosophila melanogaster
- Short gene description: NA
- Family: other
- Process: apoptosis,
- Pathways:
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): ARD1A ARD1B
- WIKI: ARD1-D_melanogaster
References [+]
- A genome-wide RNAi screen reveals multiple regulators of caspase activation.
- Yi CH, Sogah DK, Boyce M, Degterev A, Christofferson DE, Yuan J
- Apoptosis is an evolutionally conserved cellular suicide mechanism that can be activated in response to a variety of stressful stimuli. Increasing evidence suggests that apoptotic regulation relies on specialized cell death signaling pathways and also integrates diverse signals from additional regulatory circuits, including those of cellular homeostasis. We present a genome-wide RNA interference screen to systematically identify regulators of apoptosis induced by DNA damage in Drosophila melanogaster cells. We identify 47 double- stranded RNA that target a functionally diverse set of genes, including several with a known function in promoting cell death. Further characterization uncovers 10 genes that influence caspase activation upon the removal of Drosophila inhibitor of apoptosis 1. This set includes the Drosophila initiator caspase Dronc and, surprisingly, several metabolic regulators, a candidate tumor suppressor, Charlatan, and an N-acetyltransferase, ARD1. Importantly, several of these genes show functional conservation in regulating apoptosis in mammalian cells. Our data suggest a previously unappreciated fundamental connection between various cellular processes and caspase-dependent cell death. J Cell Biol. 2007 Nov 19;179(4):619-26. Epub 2007 Nov 12.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Acetyltransf_1 | 46 | 131 |
Protein sequence [+]
Ard1 | Drosophila melanogaster | 7227 | length:196
MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKGAIVGYVLAKM
EEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAA
LNLYTNALKFKIIEVEPKYYADGEDAYAMRRDLSEFADEDQAKAAKQSGEEEEKAVHRSG
GHGHSHNHSGHDGHCC
EEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAA
LNLYTNALKFKIIEVEPKYYADGEDAYAMRRDLSEFADEDQAKAAKQSGEEEEKAVHRSG
GHGHSHNHSGHDGHCC
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| Q1HQZ2_AEDAE | orthology | Aedes |
| A_gambiae_AGAP005410-PC | orthology | Anopheles |
| ARD1A | orthology | Chimpanzee |
| ARD1B | orthology | Chimpanzee |
| C_intestinalis_ENSCINP00000013819 | orthology | Ciona |
| IPI00714881.3 | orthology | Cow |
| ARD1A | orthology | Dog |
| ARD1A | orthology | Fugu |
| ARD1A | orthology | Gasterosteus |
| ARD1B | orthology | Gorilla |
| ARD1A | orthology | Gorilla |
| ARD1A | orthology | Horse |
| ARD1A | orthology | Human |
| ARD1B | orthology | Human |
| A_carolinensis_ENSACAP00000012021 | orthology | Lyzard |
| ARD1A | orthology | Macaca |
| ARD1B | orthology | Macaca |
| ARD1A | orthology | Medaka |
| M_domestica_ENSMODP00000014446 | orthology | Monodelphis |
| Ard1 | orthology | Mouse |
| Txnl4a | orthology | Mouse |
| Ard1b | orthology | Mouse |
| ARD1A | orthology | Orangutan |
| O_anatinus_ENSOANP00000004594 | orthology | Ornithorhynchus |
| ARD1B | orthology | Rabbit |
| ARD1A | orthology | Rabbit |
| LOC365732 | orthology | Rat |
| LOC365729 | orthology | Rat |
| LOC289482 | orthology | Rat |
| Ard1_predicted | orthology | Rat |
| ARD1A | orthology | Tetraodon |
| K07H8.3 | orthology | Worm |
| ard1a | orthology | Xenopus |
| ARD1 | orthology | Yeast |
| T_guttata_ENSTGUP00000015789 | orthology | Zebra finch |
| ard1a | orthology | Zebrafish |
| ard1a | orthology | Zebrafish |
| A_aegypti_AAEL009373-PA | paralogy | Aedes |
| A_aegypti_AAEL012413-PA | paralogy | Aedes |
| A_gambiae_AGAP001878-PA | paralogy | Anopheles |
| A_gambiae_AGAP003917-PA | paralogy | Anopheles |
| NAT12 | paralogy | Chicken |
| NP_001025949.1 | paralogy | Chicken |
| NAT5 | paralogy | Chicken |
| NAT12 | paralogy | Chimpanzee |
| NAT5 | paralogy | Chimpanzee |
| NAT13 | paralogy | Chimpanzee |
| C_intestinalis_ENSCINP00000010530 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000021531 | paralogy | Ciona |
| IPI00687876.3 | paralogy | Cow |
| IPI00686912.3 | paralogy | Cow |
| NAT13_BOVIN | paralogy | Cow |
| NAT5 | paralogy | Dog |
| NAT12 | paralogy | Dog |
| NAT13 | paralogy | Dog |
| san | paralogy | Fly |
| CG14222 | paralogy | Fly |
| CG32319 | paralogy | Fly |
| CG31851 | paralogy | Fly |
| CG31730 | paralogy | Fly |
| CG11412 | paralogy | Fly |
| NAT12 | paralogy | Fugu |
| NAT5 | paralogy | Fugu |
| NAT5 | paralogy | Gasterosteus |
| NAT12 | paralogy | Gasterosteus |
| NAT5 | paralogy | Gorilla |
| NAT5 | paralogy | Horse |
| NAT13 | paralogy | Horse |
| NAT12 | paralogy | Horse |
| NAT5 | paralogy | Human |
| NAT13 | paralogy | Human |
| NAT12 | paralogy | Human |
| NAT12 | paralogy | Lyzard |
| NAT13 | paralogy | Lyzard |
| NAT5 | paralogy | Lyzard |
| M_mulatta_ENSMMUP00000039993 | paralogy | Macaca |
| NAT5 | paralogy | Macaca |
| NAT12 | paralogy | Macaca |
| NAT13 | paralogy | Medaka |
| NAT5 | paralogy | Medaka |
| NAT12 | paralogy | Medaka |
| NAT13 | paralogy | Monodelphis |
| NAT12 | paralogy | Monodelphis |
| NAT5 | paralogy | Monodelphis |
| Nat5 | paralogy | Mouse |
| Nat12 | paralogy | Mouse |
| NAT12 | paralogy | Orangutan |
| NAT5 | paralogy | Orangutan |
| NAT13_PONPY | paralogy | Orangutan |
| NAT13 | paralogy | Ornithorhynchus |
| NAT12 | paralogy | Ornithorhynchus |
| O_cuniculus_ENSOCUP00000013296 | paralogy | Rabbit |
| NP_001102569.1 | paralogy | Rat |
| NP_001102065.1 | paralogy | Rat |
| NAT12 | paralogy | Tetraodon |
| NAT5 | paralogy | Tetraodon |
| B0238.10 | paralogy | Worm |
| Y97E10AL.3 | paralogy | Worm |
| Q5XGA9_XENTR | paralogy | Xenopus |
| NAT12 | paralogy | Xenopus |
| NAT3 | paralogy | Yeast |
| MAK3 | paralogy | Yeast |
| B5FY52_TAEGU | paralogy | Zebra finch |
| NAT13 | paralogy | Zebra finch |
| NAT12 | paralogy | Zebra finch |
| nat5 | paralogy | Zebrafish |
| nat13 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0055114 | oxidation reduction | biological_proccess | IEA |
| GO:0006412 | translation | biological_proccess | IEA |
| GO:0042309 | homoiothermy | biological_proccess | IEA |
| GO:0050826 | response to freezing | biological_proccess | IEA |
| GO:0004497 | monooxygenase activity | mollecular_function | IEA |
| GO:0005506 | iron ion binding | mollecular_function | IEA |
| GO:0009055 | electron carrier activity | mollecular_function | IEA |
| GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
| GO:0020037 | heme binding | mollecular_function | IEA |
| GO:0046872 | metal ion binding | mollecular_function | IEA |
| GO:0003735 | structural constituent of ribosome | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0050825 | ice binding | mollecular_function | IEA |
| GO:0005783 | endoplasmic reticulum | cell_component | IEA |
| GO:0005789 | endoplasmic reticulum membrane | cell_component | IEA |
| GO:0005792 | microsome | cell_component | IEA |
| GO:0016020 | membrane | cell_component | IEA |
| GO:0005622 | intracellular | cell_component | IEA |
| GO:0005840 | ribosome | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from FyBase [?] FBgn0036064
- Ensembl genome browser [?] : FBgn0036064
- Expression info from Arrayexpress [?] : FBgn0036064
- Protein expression from Protein Atlas: [?] FBgn0036064
Click on [?] for more information.
