ENDOB (Drosophila melanogaster)
Description [+]
- Synonyms: ENDOB
- Species: Metazoa;Bilateria;Ecdysozoa;Arthropoda;Hexapoda; Drosophila melanogaster
- Short gene description: NA
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ENDOB-D_melanogaster
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BAR | 13 | 268 |
Protein sequence [+]
endoB | Drosophila melanogaster | 7227 | length:390
MNINLPNFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEK
IVRDTESVLIPNPQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQAL
IKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNR
VKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRH
LHAFIQTQVRYYKQCGDVMEQLQRELANLGGPTPYIPLDVNEASASKSNISSGAAARGPG
NNHSANMAATGHKPNQPMHVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNE
DYMYGKQGLLKGLVPRAFVEMLDEEHDVTL
IVRDTESVLIPNPQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQAL
IKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNR
VKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRH
LHAFIQTQVRYYKQCGDVMEQLQRELANLGGPTPYIPLDVNEASASKSNISSGAAARGPG
NNHSANMAATGHKPNQPMHVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNE
DYMYGKQGLLKGLVPRAFVEMLDEEHDVTL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0008088 | axon cargo transport | biological_proccess | IMP |
GO:0016192 | vesicle-mediated transport | biological_proccess | IEP |
GO:0046328 | regulation of JNK cascade | biological_proccess | ISS |
GO:0006614 | SRP-dependent cotranslational protein targeting to membrane | biological_proccess | IEA |
GO:0045900 | negative regulation of translational elongation | biological_proccess | IEA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0007399 | nervous system development | biological_proccess | TAS |
GO:0007412 | axon target recognition | biological_proccess | IMP |
GO:0007417 | central nervous system development | biological_proccess | IMP |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0019894 | kinesin binding | mollecular_function | IPI |
GO:0005078 | MAP-kinase scaffold activity | mollecular_function | ISS |
GO:0019901 | protein kinase binding | mollecular_function | ISS |
GO:0003723 | RNA binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008312 | 7S RNA binding | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0030528 | transcription regulator activity | mollecular_function | IEA |
GO:0043565 | sequence-specific DNA binding | mollecular_function | IEA |
GO:0033897 | ribonuclease T2 activity | mollecular_function | IEA |
GO:0030140 | trans-Golgi network transport vesicle | cell_component | IDA |
GO:0000139 | Golgi membrane | cell_component | ISS |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005786 | signal recognition particle, endoplasmic reticulum targeting | cell_component | IEA |
GO:0030529 | ribonucleoprotein complex | cell_component | IEA |
GO:0048500 | signal recognition particle | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from FyBase [?] FBgn0034433
- Ensembl genome browser [?] : FBgn0034433
- Expression info from Arrayexpress [?] : FBgn0034433
- Protein expression from Protein Atlas: [?] FBgn0034433
Click on [?] for more information.