EGR (Drosophila melanogaster)
Description [+]
- Synonyms: EGR, EIGER
- Species: Metazoa;Bilateria;Ecdysozoa;Arthropoda;Hexapoda; Drosophila melanogaster
- Short gene description: NA
- Family: death ligand
- Process: cell death (other),
- Pathways: TNF/NF-kappaB signaling,
- Criteria: manually curated
- Curator comment:
- WIKI: EGR-D_melanogaster
References [+]
- Eiger, a TNF superfamily ligand that triggers the Drosophila JNK pathway.
- Igaki T, Kanda H, Yamamoto-Goto Y, Kanuka H, Kuranaga E, Aigaki T, Miura M
- Drosophila provides a powerful genetic model for studying the in vivo regulation of cell death. In our large-scale gain-of-function screen, we identified Eiger, the first invertebrate tumor necrosis factor (TNF) superfamily ligand that can induce cell death. Eiger is a type II transmembrane protein with a C-terminal TNF homology domain. It is predominantly expressed in the nervous system. Genetic evidence shows that Eiger induces cell death by activating the Drosophila JNK pathway. Although this cell death process is blocked by Drosophila inhibitor-of-apoptosis protein 1 (DIAP1), it does not require caspase activity. We also show genetically that Eiger is a physiological ligand for the Drosophila JNK pathway. Our findings demonstrate that Eiger can initiate cell death through an IAP-sensitive cell death pathway via JNK signaling. EMBO J. 2002 Jun 17;21(12):3009-18.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNF | 304 | 415 |
Protein sequence [+]
egr | Drosophila melanogaster | 7227 | length:415
MTAETLKPFITPTSANDDGFPAKATSTATAQRRTRQLIPLVLGFIGLGLVVAILALTIWQ
TTRVSHLDKELKSLKRVVDNLQQRLGINYLDEFDEFQKEYENALIDYPKKVDGLTDEEDD
DDGDGLDSIADDEDDDVSYSSVDDVGADYEDYTDMLNKLNNAHTGTTPTSETTAEGEGET
DSASSASNDDNVFDDFTSYNAHKKKQERKSRSIADVRNEEQNIQGNHTELQEKSSNEATS
KESPAPLHHRRRMHSRHRHLLVRKGESLLSARSEDSRPAAHFHLSSRRRHQGSMGYHGDM
YIGNDNERNSYQGHFQTRDGVLTVTNTGLYYVYAQICYNNSHDQNGFIVFQGDTPFLQCL
NTVPTNMPHKVHTCHTSGLIHLERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV
TTRVSHLDKELKSLKRVVDNLQQRLGINYLDEFDEFQKEYENALIDYPKKVDGLTDEEDD
DDGDGLDSIADDEDDDVSYSSVDDVGADYEDYTDMLNKLNNAHTGTTPTSETTAEGEGET
DSASSASNDDNVFDDFTSYNAHKKKQERKSRSIADVRNEEQNIQGNHTELQEKSSNEATS
KESPAPLHHRRRMHSRHRHLLVRKGESLLSARSEDSRPAAHFHLSSRRRHQGSMGYHGDM
YIGNDNERNSYQGHFQTRDGVLTVTNTGLYYVYAQICYNNSHDQNGFIVFQGDTPFLQCL
NTVPTNMPHKVHTCHTSGLIHLERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| A_aegypti_AAEL010524-PA | orthology | Aedes |
| XR_026669.1 | orthology | Chicken |
| zgc:153941 | orthology | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006955 | immune response | biological_proccess | IEA |
| GO:0045087 | innate immune response | biological_proccess | IEA |
| GO:0046853 | inositol and derivative phosphorylation | biological_proccess | IMP |
| GO:0042309 | homoiothermy | biological_proccess | IEA |
| GO:0050826 | response to freezing | biological_proccess | IEA |
| GO:0006412 | translation | biological_proccess | IEA |
| GO:0006835 | dicarboxylic acid transport | biological_proccess | IEA |
| GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
| GO:0000166 | nucleotide binding | mollecular_function | IEA |
| GO:0016301 | kinase activity | mollecular_function | IEA |
| GO:0016740 | transferase activity | mollecular_function | IEA |
| GO:0005524 | ATP binding | mollecular_function | IEA |
| GO:0035299 | inositol pentakisphosphate 2-kinase activity | mollecular_function | IEA |
| GO:0050825 | ice binding | mollecular_function | IEA |
| GO:0003735 | structural constituent of ribosome | mollecular_function | IEA |
| GO:0017153 | sodium:dicarboxylate symporter activity | mollecular_function | IEA |
| GO:0003677 | DNA binding | mollecular_function | IEA |
| GO:0004879 | ligand-dependent nuclear receptor activity | mollecular_function | IEA |
| GO:0005576 | extracellular region | cell_component | IEA |
| GO:0005575 | cellular_component | cell_component | ND |
| GO:0005622 | intracellular | cell_component | IEA |
| GO:0005840 | ribosome | cell_component | IEA |
| GO:0016020 | membrane | cell_component | IEA |
| GO:0005634 | nucleus | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from FyBase [?] FBgn0033483
- Ensembl genome browser [?] : FBgn0033483
- Expression info from Arrayexpress [?] : FBgn0033483
- Protein expression from Protein Atlas: [?] FBgn0033483
Click on [?] for more information.
