ZGC:86706 (Danio rerio)
Description [+]
- Synonyms: ZGC:86706
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: Cytochrome c. [Source:UniProtKB/Swiss-Prot;Acc:Q6IQM2]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ZGC:86706-D_rerio
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Cytochrom_C | 4 | 103 |
Protein sequence [+]
zgc:86706 | Danio rerio | 7955 | length:104
MGDVEKGKKVFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGFSYTDANKSKGIVW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKSATS
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKSATS
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0005506 | iron ion binding | mollecular_function | IEA |
| GO:0009055 | electron carrier activity | mollecular_function | IEA |
| GO:0020037 | heme binding | mollecular_function | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-040625-38
- Ensembl genome browser [?] : ENSDARG00000044562
- Expression info from Arrayexpress [?] : ENSDARG00000044562
- Protein expression from Protein Atlas: [?] ENSDARG00000044562
- Community gene edition from Wikigenes: [?] 415158
- entrezgene: 415158
- refseq_dna: NM_001002068
- refseq_peptide: NP_001002068
Click on [?] for more information.
