TRADD (Danio rerio)
Description [+]
- Synonyms: TRADD, TUMOR NECROSIS FACTOR RECEPTOR TYPE 1-ASSOCIATED DEATH DOMAIN PROTEIN, ZGC:103556, WU:FC59E02
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Pisces; Danio rerio
- Short gene description: Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein) (TNFRSF1A-associated via death domain protein). [Source:UniProtKB/Swiss-Prot;Acc:Q9I9N5]
- Family: Death Domain-containing protein : DD adapter protein
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment: Ectopic expression of TRADD in zebrafish embryos induces apoptosis [16888647] . Knockdown of TRADD using antisense morpholino oligonucleotides does not protect zebrafish embryos from apoptosis induced by ectopic expression of Apo2L/TRAIL orthologs [16888647] .
- Human ortholog(s): TRADD
- WIKI: TRADD-D_rerio
References [+]
- Delineation of the cell-extrinsic apoptosis pathway in the zebrafish.
- Eimon PM, Kratz E, Varfolomeev E, Hymowitz SG, Stern H, Zha J, Ashkenazi A
- The mammalian extrinsic apoptosis pathway is triggered by Fas ligand (FasL) and Apo2 ligand/tumor necrosis factor (TNF)-related apoptosis-inducing ligand (Apo2L/TRAIL). Ligand binding to cognate receptors activates initiator caspases directly in a death-inducing signaling complex. In Drosophila, TNF ligand binding activates initiator caspases indirectly, through JNK. We characterized the extrinsic pathway in zebrafish to determine how it operates in a nonmammalian vertebrate. We identified homologs of FasL and Apo2L/TRAIL, their receptors, and other components of the cell death machinery. Studies with three Apo2L/TRAIL homologs demonstrated that they bind the receptors zHDR (previously linked to hematopoiesis) and ovarian TNFR (zOTR). Ectopic expression of these ligands during embryogenesis induced apoptosis in erythroblasts and notochord cells. Inhibition of zHDR, zOTR, the adaptor zFADD, or caspase-8-like proteases blocked ligand-induced apoptosis, as did antiapoptotic Bcl-2 family members. Thus, the extrinsic apoptosis pathway in zebrafish closely resembles its mammalian counterpart and cooperates with the intrinsic pathway to trigger tissue-specific apoptosis during embryogenesis in response to ectopic Apo2L/TRAIL expression. Cell Death Differ. 2006 Oct;13(10):1619-30. Epub 2006 Aug 4.
- References from Human ortholog(s):
- The TNF receptor 1-associated protein TRADD signals cell death and NF-kappa B activation.
- Hsu H, Xiong J, Goeddel DV
- Many diverse activities of tumor necrosis factor (TNF) are signaled through TNF receptor 1 (TNFR1). We have identified a novel 34 kDa protein, designated TRADD, that specifically interacts with an intracellular domain of TNFR1 known to be essential for mediating programmed cell death. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa B. The C-terminal 118 amino acids of TRADD are sufficient to trigger both of these activities and likewise sufficient for interaction with the death domain of TNFR1. TRADD-mediated cell death can be suppressed by the crmA gene, which encodes a specific inhibitor of the interleukin-1 beta-converting enzyme. However, NF-kappa B activation by TRADD is not inhibited by crmA expression, demonstrating that the signaling pathways for TNF-induced cell death and NF-kappa B activation are distinct. Cell. 1995 May 19;81(4):495-504.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TRADD_N | 59 | 170 |
PFAM A | Death | 202 | 290 |
Protein sequence [+]
tradd | Danio rerio | 7955 | length:293
MDSIDTKRLNDSNASDRALSGCAVLFLGCSSLEHNFLSLYKDERGKFSVFKVIKLTLSDS
VGGLEGYEILKLHDADPYLGVELKFMAMPPCQRFLESYACGSLTQFLSQHASRLLALPDG
VEIETQLKAGVHTLDHSLQDIEICLDHIRQSQPVRLRDDEVTQLEQQLQNSYGPPSQPPQ
ELPRNCFLFQKRVFDDRPLTPADQQRFAAHVGRDWKRVGRALQKNCRALKGPAIDNLAYE
YEREGLYEQAYQLLGRFIQSEGRSAKLSRLISALEETKMTSMAEIMLGIQPRD
VGGLEGYEILKLHDADPYLGVELKFMAMPPCQRFLESYACGSLTQFLSQHASRLLALPDG
VEIETQLKAGVHTLDHSLQDIEICLDHIRQSQPVRLRDDEVTQLEQQLQNSYGPPSQPPQ
ELPRNCFLFQKRVFDDRPLTPADQQRFAAHVGRDWKRVGRALQKNCRALKGPAIDNLAYE
YEREGLYEQAYQLLGRFIQSEGRSAKLSRLISALEETKMTSMAEIMLGIQPRD
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
TRADD | orthology | Chicken |
TRADD | orthology | Chimpanzee |
TRADD_BOVIN | orthology | Cow |
TRADD | orthology | Dog |
TRADD | orthology | Fugu |
TRADD | orthology | Gasterosteus |
TRADD | orthology | Gorilla |
TRADD | orthology | Horse |
TRADD | orthology | Human |
TRADD | orthology | Macaca |
TRADD | orthology | Medaka |
TRADD | orthology | Monodelphis |
Tradd | orthology | Mouse |
Tradd | orthology | Rat |
TRADD | orthology | Tetraodon |
TRADD | orthology | Zebra finch |
NP_001100820.1 | paralogy | Rat |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0043065 | positive regulation of apoptosis | biological_proccess | IDA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004871 | signal transducer activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005856 | cytoskeleton | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from ZFIN [?] ZDB-GENE-000511-5
- Ensembl genome browser [?] : ENSDARG00000036057
- Expression info from Arrayexpress [?] : ENSDARG00000036057
- Protein expression from Protein Atlas: [?] ENSDARG00000036057
- Community gene edition from Wikigenes: [?] 58130
Click on [?] for more information.