Q4JIK2_HORSE (Equus caballus)
Description [+]
- Synonyms: Q4JIK2_HORSE
- Species: Equus caballus
- Short gene description: Myeloid differentiation primary response 88 (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q4JIK2]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q4JIK2_HORSE-E_caballus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Death | 31 | 109 |
PFAM A | TIR | 163 | 292 |
Protein sequence [+]
Q4JIK2_HORSE | Equus caballus | 9796 | length:296
MAAGGPGVGSAPHIPSASSLPLAALNVRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLE
IRQLETHTDPTGSLLDDWQGRPGASVGRLLELLAKLGRDDVLVELGPSIEEDCQKYILKQ
QQQESEKPLQVAAVDSSVPRTAELAGITTLDDPLGQMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
IRQLETHTDPTGSLLDDWQGRPGASVGRLLELLAKLGRDDVLVELGPSIEEDCQKYILKQ
QQQESEKPLQVAAVDSSVPRTAELAGITTLDDPLGQMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002238 | response to molecule of fungal origin | biological_proccess | IEA |
GO:0002755 | MyD88-dependent toll-like receptor signaling pathway | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0009615 | response to virus | biological_proccess | IEA |
GO:0016064 | immunoglobulin mediated immune response | biological_proccess | IEA |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0032760 | positive regulation of tumor necrosis factor production | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0045080 | positive regulation of chemokine biosynthetic process | biological_proccess | IEA |
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0045351 | type I interferon biosynthetic process | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0031224 | intrinsic to membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSECAG00000001774
- Expression info from Arrayexpress [?] : ENSECAG00000001774
- Protein expression from Protein Atlas: [?] ENSECAG00000001774
- Community gene edition from Wikigenes: [?] 100053940
- entrezgene: 100053940
Click on [?] for more information.