CD40LG (Equus caballus)
Description [+]
- Synonyms: CD40LG
- Species: Equus caballus
- Short gene description: CD40 ligand (CD40-L)(Tumor necrosis factor ligand superfamily member 5)(TNF-related activation protein)(TRAP)(T-cell antigen Gp39)(CD154 antigen) [Contains CD40 ligand, membrane form;CD40 ligand, soluble form] [Source:UniProtKB/Swiss-Prot;Acc:P29965]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD40LG-E_caballus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 138 | 261 |
Protein sequence [+]
CD40LG | Equus caballus | 9796 | length:261
MIETYSQPSPRSVATGPPVSMKIFMYLLTVFLITQMIVSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNKGEGPLSLLNCEEIRSQFEGFVKDIMLNEEVKKKGENFEMQKGDQEP
QIAAHVISEASSKTASVLQWAQKGYYTISNNLVTLENGKQLAVKRQGLYYIYAQVTFCSN
REASGQAPFIASLCLRSVSGSERILLRAANTHSSSKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
EDFVFMKTIQRCNKGEGPLSLLNCEEIRSQFEGFVKDIMLNEEVKKKGENFEMQKGDQEP
QIAAHVISEASSKTASVLQWAQKGYYTISNNLVTLENGKQLAVKRQGLYYIYAQVTFCSN
REASGQAPFIASLCLRSVSGSERILLRAANTHSSSKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0030183 | B cell differentiation | biological_proccess | IEA |
GO:0045190 | isotype switching | biological_proccess | IEA |
GO:0048305 | immunoglobulin secretion | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0030168 | platelet activation | biological_proccess | IEA |
GO:0042100 | B cell proliferation | biological_proccess | IEA |
GO:0032735 | positive regulation of interleukin-12 production | biological_proccess | IEA |
GO:0005174 | CD40 receptor binding | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSECAG00000011392
- Expression info from Arrayexpress [?] : ENSECAG00000011392
- Protein expression from Protein Atlas: [?] ENSECAG00000011392
- Community gene edition from Wikigenes: [?] 100054624
- entrezgene: 100054624
Click on [?] for more information.