Q5ZLJ0_CHICK (Gallus gallus)
Description [+]
- Synonyms: Q5ZLJ0_CHICK
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: Hypothetical protein (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q5ZLJ0]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q5ZLJ0_CHICK-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 25 | 309 |
PFAM A | Pkinase_Tyr | 25 | 251 |
Protein sequence [+]
Q5ZLJ0_CHICK | Gallus gallus | 9031 | length:361
EMSQERPKFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCSAFDTKTGLRVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSLEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV
GTPGPELLKKISSESARNYIQSLSYMPKMNFENVFIGANPLAVDLLEKMLVLDTDKRITA
AEALAHAYFAQYHDPDDEPVADPYDQSFESRELEIEEWKSLTYDEVISFVPPPLDQEEME
S
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSLEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLV
GTPGPELLKKISSESARNYIQSLSYMPKMNFENVFIGANPLAVDLLEKMLVLDTDKRITA
AEALAHAYFAQYHDPDDEPVADPYDQSFESRELEIEEWKSLTYDEVISFVPPPLDQEEME
S
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000077 | DNA damage checkpoint | biological_proccess | IEA |
GO:0001525 | angiogenesis | biological_proccess | IEA |
GO:0002062 | chondrocyte differentiation | biological_proccess | IEA |
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0007519 | skeletal muscle development | biological_proccess | IEA |
GO:0019395 | fatty acid oxidation | biological_proccess | IEA |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0032495 | response to muramyl dipeptide | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0045648 | positive regulation of erythrocyte differentiation | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0006950 | response to stress | biological_proccess | IEA |
GO:0000902 | cell morphogenesis | biological_proccess | IEA |
GO:0007243 | protein kinase cascade | biological_proccess | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0000922 | spindle pole | cell_component | IEA |
GO:0005623 | cell | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000019759
- Expression info from Arrayexpress [?] : ENSGALG00000019759
- Protein expression from Protein Atlas: [?] ENSGALG00000019759
- entrezgene: 421183
Click on [?] for more information.