NP_001020000.1 (Gallus gallus)
Description [+]
- Synonyms: NP_001020000.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: toll-interleukin 1 receptor (TIR) domain containing adaptor protein [Source:RefSeq_peptide;Acc:NP_001020000]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001020000.1-G_gallus
Structure & Sequence [+]
Protein sequence [+]
NP_001020000.1 | Gallus gallus | 9031 | length:220
AGWFRRLLQKPKQSSIHASSSSHSTTSHSLSSSPSSFSSSSSAWSSSSSSSTSTAQPSRP
APVDISSSSSARWVKSYDVCICHSEVDLEFVEELVSYLESQPQSLRCFLQLRDSVAGSAV
MTELCEAVQNSHCWVMLITPSFLQDPWCRYQMHQALAEAPMANGRTIPVLKDIDRKDYPR
ELRNLYYIYVALKENSFRQIRDTVLRYLEELCRSSTSGMQ
APVDISSSSSARWVKSYDVCICHSEVDLEFVEELVSYLESQPQSLRCFLQLRDSVAGSAV
MTELCEAVQNSHCWVMLITPSFLQDPWCRYQMHQALAEAPMANGRTIPVLKDIDRKDYPR
ELRNLYYIYVALKENSFRQIRDTVLRYLEELCRSSTSGMQ
Structure links:
- Smartdomain prediction information: SM00255
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0007249 | I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0030099 | myeloid cell differentiation | biological_proccess | IEA |
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0031224 | intrinsic to membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000001077
- Expression info from Arrayexpress [?] : ENSGALG00000001077
- Protein expression from Protein Atlas: [?] ENSGALG00000001077
- entrezgene: 419715
- refseq_dna: NM_001024829
- refseq_peptide: NP_001020000
Click on [?] for more information.