TNR16_CHICK (Gallus gallus)
Description [+]
- Synonyms: TNR16_CHICK
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: Tumor necrosis factor receptor superfamily member 16 precursor (Low- affinity nerve growth factor receptor) (NGF receptor) (Gp80-LNGFR) (p75 ICD) (Low affinity neurotrophin receptor p75NTR). [Source:UniProtKB/Swiss-Prot;Acc:P18519]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNR16_CHICK-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 59 | 99 |
PFAM A | TNFR_c6 | 101 | 138 |
PFAM A | TNFR_c6 | 141 | 180 |
Protein sequence [+]
TNR16_CHICK | Gallus gallus | 9031 | length:181
MAGFVPLLLLLLPAGPTWGSKEKCLTKMYTTSGECCKACNLGEGVVQPCGVNQTVCEPCL
DSVTYSDTVSATEPCKPCTQCVGLHSMSAPCVESDDAVCRCAYGYFQDELSGSCKECSIC
EVGFGLMFPCRDSQDTVCEECPEGTFSDEANFVDPCLPCTICEENEVMVKECTATSDAEC
R
DSVTYSDTVSATEPCKPCTQCVGLHSMSAPCVESDDAVCRCAYGYFQDELSGSCKECSIC
EVGFGLMFPCRDSQDTVCEECPEGTFSDEANFVDPCLPCTICEENEVMVKECTATSDAEC
R
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0007399 | nervous system development | biological_proccess | IEA |
GO:0007411 | axon guidance | biological_proccess | IEA |
GO:0007417 | central nervous system development | biological_proccess | IEA |
GO:0010468 | regulation of gene expression | biological_proccess | IEA |
GO:0016048 | detection of temperature stimulus | biological_proccess | IEA |
GO:0021675 | nerve development | biological_proccess | IEA |
GO:0030154 | cell differentiation | biological_proccess | IEA |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IEA |
GO:0040037 | negative regulation of fibroblast growth factor receptor signaling pathway | biological_proccess | IEA |
GO:0042488 | positive regulation of odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IEA |
GO:0048146 | positive regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0051799 | negative regulation of hair follicle development | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005035 | death receptor activity | mollecular_function | IEA |
GO:0048406 | nerve growth factor binding | mollecular_function | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000012504
- Expression info from Arrayexpress [?] : ENSGALG00000012504
- Protein expression from Protein Atlas: [?] ENSGALG00000012504
- entrezgene: 425805
Click on [?] for more information.