NP_001025950.1 (Gallus gallus)
Description [+]
- Synonyms: NP_001025950.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: hypothetical protein LOC418325 [Source:RefSeq_peptide;Acc:NP_001025950]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001025950.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 61 | 97 |
PFAM A | TNFR_c6 | 100 | 141 |
PFAM A | TNFR_c6 | 143 | 180 |
PFAM A | Death | 330 | 412 |
Protein sequence [+]
NP_001025950.1 | Gallus gallus | 9031 | length:427
MRGLALPRSSLGTVILTFVCVLVEESVGIAPVPYMLQLRRATLDGRDPFNRLRREKRQVQ
CQLGQYLHPKGTHCCMRCHAGTYKLKDCEWSGQAPVCLPCPNGTFTAVDNIMEKCFQCTR
CRTELQQIEKTPCTQKQDTVCGCRKNQYQFGEADFFQCKNCSSCANGIITNCSKNSDAVC
RCKPMFFMTLNNVCKHCNSCVGEECLQCSSPVTTSPNSSELNGNLVLGIIVAIFVVICVI
YVVNKAVKLVQKNGIASSFYSCVSLPQTSKESVSEAEVKGSAITVLPEIQKEKELLVNAT
PPSVPLLQSSHELPDCVRAARKRQLPDNPAILYTVVDHVPPSRWKEFVRRLGLTENDLER
IEMEHRHLRDAQYEMVSLWKLQMGHAATVEHISCVLNQMELSGCSEAIQEALLNQNSHQP
CSFHSHR
CQLGQYLHPKGTHCCMRCHAGTYKLKDCEWSGQAPVCLPCPNGTFTAVDNIMEKCFQCTR
CRTELQQIEKTPCTQKQDTVCGCRKNQYQFGEADFFQCKNCSSCANGIITNCSKNSDAVC
RCKPMFFMTLNNVCKHCNSCVGEECLQCSSPVTTSPNSSELNGNLVLGIIVAIFVVICVI
YVVNKAVKLVQKNGIASSFYSCVSLPQTSKESVSEAEVKGSAITVLPEIQKEKELLVNAT
PPSVPLLQSSHELPDCVRAARKRQLPDNPAILYTVVDHVPPSRWKEFVRRLGLTENDLER
IEMEHRHLRDAQYEMVSLWKLQMGHAATVEHISCVLNQMELSGCSEAIQEALLNQNSHQP
CSFHSHR
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0006952 | defense response | biological_proccess | IEA |
GO:0019221 | cytokine-mediated signaling pathway | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0050729 | positive regulation of inflammatory response | biological_proccess | IEA |
GO:0009816 | defense response to bacterium, incompatible interaction | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0045121 | membrane raft | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000014890
- Expression info from Arrayexpress [?] : ENSGALG00000014890
- Protein expression from Protein Atlas: [?] ENSGALG00000014890
- entrezgene: 418325
- entrezgene: 777018
- refseq_dna: NM_001030779
- refseq_peptide: NP_001025950
Click on [?] for more information.