A3RF19_CHICK (Gallus gallus)
Description [+]
- Synonyms: A3RF19_CHICK
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: Tumor necrosis factor ligand superfamily member 11. [Source:UniProtKB/TrEMBL;Acc:A3RF19]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: A3RF19_CHICK-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 112 | 240 |
Protein sequence [+]
A3RF19_CHICK | Gallus gallus | 9031 | length:244
MDPSRISKEDAHCVRMLFRSQESIDLQDTPFENQEVKLMPESCRRMKQALQRAVQKEVQR
ILGKESPRPEKAAMEAIGMELYRRNKPEKQPFAHLIIDDKNIPTGTRKVNLTSWHHDKGQ
ANLSNMTFSDGKLIVNQDGFYYLYANICFRHHETSGNLTKRGLQLMVYMTKTNLKIRRSD
VLMKGGSTKYWSGNSEFHFYSVNIGGFLKLKTGDMISIQVSNPLLLDSSQEATYFGAFKV
RDLD
ILGKESPRPEKAAMEAIGMELYRRNKPEKQPFAHLIIDDKNIPTGTRKVNLTSWHHDKGQ
ANLSNMTFSDGKLIVNQDGFYYLYANICFRHHETSGNLTKRGLQLMVYMTKTNLKIRRSD
VLMKGGSTKYWSGNSEFHFYSVNIGGFLKLKTGDMISIQVSNPLLLDSSQEATYFGAFKV
RDLD
Structure links:
- Smartdomain prediction information: SM00207
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001503 | ossification | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0030316 | osteoclast differentiation | biological_proccess | IEA |
GO:0045453 | bone resorption | biological_proccess | IEA |
GO:0045670 | regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0045672 | positive regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0051260 | protein homooligomerization | biological_proccess | IEA |
GO:0045780 | positive regulation of bone resorption | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000016961
- Expression info from Arrayexpress [?] : ENSGALG00000016961
- Protein expression from Protein Atlas: [?] ENSGALG00000016961
- entrezgene: 428067
Click on [?] for more information.