NP_001019749.1 (Gallus gallus)
Description [+]
- Synonyms: NP_001019749.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: tumor necrosis factor (ligand) superfamily, member 15 [Source:RefSeq_peptide;Acc:NP_001019749]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001019749.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 114 | 239 |
Protein sequence [+]
NP_001019749.1 | Gallus gallus | 9031 | length:239
MDHGAEITLEEASATGQASRMHIKEDLRRMRCAVLLCLLAVLLLALPIAYLLAGNLRAPT
SCPQVVDERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKR
GLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPT
QLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL
SCPQVVDERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKR
GLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPT
QLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL
Structure links:
- Smartdomain prediction information: SM00207
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0001937 | negative regulation of endothelial cell proliferation | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | IEA |
GO:0042107 | cytokine metabolic process | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000007174
- Expression info from Arrayexpress [?] : ENSGALG00000007174
- Protein expression from Protein Atlas: [?] ENSGALG00000007174
- entrezgene: 777589
- entrezgene: 417247
- refseq_dna: NM_001024578
- refseq_peptide: NP_001019749
Click on [?] for more information.