BIRC1 (Homo sapiens)
Description [+]
- Synonyms: BIRC1, NLRB1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Baculoviral IAP repeat-containing protein 1 (Neuronal apoptosis inhibitory protein) [Source:UniProtKB/Swiss-Prot;Acc:Q13075]
- Family: other
- Process: immunity,
- Pathways: inflammasome,
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Naip2 Birc1-rs1 Naip6 Naip1 Naip4 Naip5
- WIKI: BIRC1-H_sapiens
References [+]
- Suppression of apoptosis in mammalian cells by NAIP and a related family of IAP genes.
- Liston P, Roy N, Tamai K, Lefebvre C, Baird S, Cherton-Horvat G, Farahani R, McLean M, Ikeda JE, MacKenzie A, Korneluk RG
- Dysregulation of apoptosis can result in inappropriate suppression of cell death, as occurs in the development of some cancers, or in failure to control the extent of cell death, as is believed to occur in acquired immunodeficiency and certain neurodegenerative disorders, such as spinal muscular atrophy (SMA). Recently, we isolated a candidate gene, encoding neuronal apoptosis inhibitor protein (NAIP), for SMA. This gene is homologous to two baculovirus inhibitor of apoptosis proteins (Cp-IAP and Op-IAP) and is partly deleted in individuals with type I SMA. A second SMA candidate gene encoding survival motor neuron (SMN), which is contiguous with the NAIP locus on 5q13.1, was also reported. Here we demonstrate a NAIP-mediated inhibition of apoptosis induced by a variety of signals, and have identified three additional human complementary DNAs and a Drosophila melanogaster sequence that are also homologous to the baculovirus IAPs. The four open reading frames (ORFs) possess three baculoviral inhibition of apoptosis protein repeat (BIR) domains and a carboxy-terminal RING zinc-finger. The human iap genes have a distinct but overlapping pattern of expression in fetal and adult tissues. These proteins significantly increase the number of known apoptotic suppressors. Nature. 1996 Jan 25;379(6563):349-53.
- Inhibitor of apoptosis proteins in eukaryotic evolution and development: a model of thematic conservation.
- O'Riordan MX, Bauler LD, Scott FL, Duckett CS
- The past decade and a half has witnessed the discovery of a large, evolutionarily conserved family of cellular genes bearing homology to the prototype baculovirus Inhibitor of Apoptosis (IAP). The logical decision in the field to also refer to these cellular proteins as IAPs fails to do justice to this versatile group of factors that play a wide range of roles in eukaryotic development and homeostasis which include, but are not limited to, the regulation of programmed cell death. Here we describe the shared functional characteristics of several well-characterized IAPs whose defining motifs place them more in the category of multifunctional modular protein interaction domains. Dev Cell. 2008 Oct;15(4):497-508.
- References from Mouse ortholog(s):
- Critical function for Naip5 in inflammasome activation by a conserved carboxy-terminal domain of flagellin.
- Lightfield KL, Persson J, Brubaker SW, Witte CE, von Moltke J, Dunipace EA, Henry T, Sun YH, Cado D, Dietrich WF, Monack DM, Tsolis RM, Vance RE
- Inflammasomes are cytosolic multiprotein complexes that sense microbial infection and trigger cytokine production and cell death. However, the molecular components of inflammasomes and what they sense remain poorly defined. Here we demonstrate that 35 amino acids of the carboxyl terminus of flagellin triggered inflammasome activation in the absence of bacterial contaminants or secretion systems. To further elucidate the host flagellin-sensing pathway, we generated mice deficient in the intracellular sensor Naip5. These mice failed to activate the inflammasome in response to the 35 amino acids of flagellin or in response to Legionella pneumophila infection. Our data clarify the molecular basis for the cytosolic response to flagellin. Nat Immunol. 2008 Oct;9(10):1171-8. Epub 2008 Aug 24.
- Naip5 affects host susceptibility to the intracellular pathogen Legionella pneumophila.
- Wright EK, Goodart SA, Growney JD, Hadinoto V, Endrizzi MG, Long EM, Sadigh K, Abney AL, Bernstein-Hanley I, Dietrich WF
- BACKGROUND: Legionella pneumophila is a gram-negative bacterial pathogen that is the cause of Legionnaires' Disease. Legionella produces disease because it can replicate inside a specialized compartment of host macrophages. Macrophages isolated from various inbred mice exhibit large differences in permissiveness for intracellular replication of Legionella. A locus affecting this host-resistance phenotype, Lgn1, has been mapped to chromosome 13, but the responsible gene has not been identified. RESULTS: Here, we report that Naip5 (also known as Birc1e) influences susceptibility to Legionella. Naip5 encodes a protein that is homologous to plant innate immunity (so-called resistance) proteins and has been implicated in signaling pathways related to apoptosis regulation. Detailed recombination mapping and analysis of expression implicates Naip5 in the Legionella permissiveness differences among mouse strains. A bacterial artificial chromosome (BAC) transgenic line expressing a nonpermissive allele of Naip5 exhibits a reduction in macrophage Legionella permissiveness. In addition, morpholino-based antisense inhibition of Naip5 causes an increase in the Legionella permissiveness of macrophages. CONCLUSIONS: We conclude that polymorphisms in Naip5 are involved in the permissiveness differences of mouse macrophages for intracellular Legionella replication. We speculate that Naip5 is a functional mammalian homolog of plant resistance proteins that monitor for, and initiate host response to, the presence of secreted bacterial virulence proteins. Curr Biol. 2003 Jan 8;13(1):27-36.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | BIR | 63 | 128 |
| PFAM A | BIR | 162 | 228 |
| PFAM A | BIR | 281 | 346 |
| PFAM A | NACHT | 464 | 618 |
Protein sequence [+]
BIRC1 | Homo sapiens | 9606 | length:1403
MATQQKASDERISQFDHNLLPELSALLGLDAVQLAKELEEEEQKERAKMQKGYNSQMRSE
AKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIEDHKRF
HPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCV
LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKKSSEEITQYI
QSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEELRLDSFKDWPRESAVGVAALA
KAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKSSAEVTPDLQS
RGELCELLETTSESNLEDSIAVGPIVPEMAQGEAQWFQEAKNLNEQLRAAYTSASFRHMS
LLDISSDLATDHLLGCDLSIASKHISKPVQEPLVLPEVFGNLNSVMCVEGEAGSGKTVLL
KKIAFLWASGCCPLLNRFQLVFYLSLSSTRPDEGLASIICDQLLEKEGSVTEMCVRNIIQ
QLKNQVLFLLDDYKEICSIPQVIGKLIQKNHLSRTCLLIAVRTNRARDIRRYLETILEIK
AFPFYNTVCILRKLFSHNMTRLRKFMVYFGKNQSLQKIQKTPLFVAAICAHWFQYPFDPS
FDDVAVFKSYMERLSLRNKATAEILKATVSSCGELALKGFFSCCFEFNDDDLAEAGVDED
EDLTMCLMSKFTAQRLRPFYRFLSPAFQEFLAGMRLIELLDSDRQEHQDLGLYHLKQINS
PMMTVSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLENISENDDYLKHQPEISLQ
MQLLRGLWQICPQAYFSMVSEHLLVLALKTAYQSNTVAACSPFVLQFLQGRTLTLGALNL
QYFFDHPESLSLLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEW
ERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVVGQDMLEIL
MTVFSASQRIELHLNHSRGFIESIRPALELSKASVTKCSISKLELSAAEQELLLTLPSLE
SLEVSGTIQSQDQIFPNLDKFLCLKELSVDLEGNINVFSVIPEEFPNFHHMEKLLIQISA
EYDPSKLVKLIQNSPNLHVFHLKCNFFSDFGSLMTMLVSCKKLTEIKFSDSFFQAVPFVA
SLPNFISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELILPTGDGIYRVAKLIIQQCQ
QLHCLRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSINHKITEEGYRNFFQALDNM
PNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKER
HPQSKYLTILQKWILPFSPIIQK
AKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIEDHKRF
HPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCV
LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKKSSEEITQYI
QSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEELRLDSFKDWPRESAVGVAALA
KAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKSSAEVTPDLQS
RGELCELLETTSESNLEDSIAVGPIVPEMAQGEAQWFQEAKNLNEQLRAAYTSASFRHMS
LLDISSDLATDHLLGCDLSIASKHISKPVQEPLVLPEVFGNLNSVMCVEGEAGSGKTVLL
KKIAFLWASGCCPLLNRFQLVFYLSLSSTRPDEGLASIICDQLLEKEGSVTEMCVRNIIQ
QLKNQVLFLLDDYKEICSIPQVIGKLIQKNHLSRTCLLIAVRTNRARDIRRYLETILEIK
AFPFYNTVCILRKLFSHNMTRLRKFMVYFGKNQSLQKIQKTPLFVAAICAHWFQYPFDPS
FDDVAVFKSYMERLSLRNKATAEILKATVSSCGELALKGFFSCCFEFNDDDLAEAGVDED
EDLTMCLMSKFTAQRLRPFYRFLSPAFQEFLAGMRLIELLDSDRQEHQDLGLYHLKQINS
PMMTVSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLENISENDDYLKHQPEISLQ
MQLLRGLWQICPQAYFSMVSEHLLVLALKTAYQSNTVAACSPFVLQFLQGRTLTLGALNL
QYFFDHPESLSLLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEW
ERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVVGQDMLEIL
MTVFSASQRIELHLNHSRGFIESIRPALELSKASVTKCSISKLELSAAEQELLLTLPSLE
SLEVSGTIQSQDQIFPNLDKFLCLKELSVDLEGNINVFSVIPEEFPNFHHMEKLLIQISA
EYDPSKLVKLIQNSPNLHVFHLKCNFFSDFGSLMTMLVSCKKLTEIKFSDSFFQAVPFVA
SLPNFISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELILPTGDGIYRVAKLIIQQCQ
QLHCLRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSINHKITEEGYRNFFQALDNM
PNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKER
HPQSKYLTILQKWILPFSPIIQK
Structure links:
- Smartdomain prediction information: SM00238
- Smartdomain prediction information: SM00382
- Prosite motif and domain information: PS01282
- Profile motif and domain profile information: PS50837
- Profile motif and domain profile information: PS50143
- Interpro domain information: Q13075
- PFAM domain and domain family information: Q13075
- Protein 3D structures from PDB: 2VM5
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| P_troglodytes_ENSPTRP00000048273 | orthology | Chimpanzee |
| XM_001156604.1 | orthology | Chimpanzee |
| IPI00689691.3 | orthology | Cow |
| IPI00689691.3 | orthology | Cow |
| E_caballus_ENSECAP00000002314 | orthology | Horse |
| XP_001504091.2 | orthology | Horse |
| A_carolinensis_ENSACAP00000009897 | orthology | Lyzard |
| A_carolinensis_ENSACAP00000009897 | orthology | Lyzard |
| M_mulatta_ENSMMUP00000034549 | orthology | Macaca |
| XM_001093532.1 | orthology | Macaca |
| Naip2 | orthology | Mouse |
| Naip2 | orthology | Mouse |
| Birc1-rs1 | orthology | Mouse |
| Naip6 | orthology | Mouse |
| Naip1 | orthology | Mouse |
| Naip4 | orthology | Mouse |
| Naip5 | orthology | Mouse |
| Naip5 | orthology | Mouse |
| P_pygmaeus_ENSPPYP00000017359 | orthology | Orangutan |
| P_pygmaeus_ENSPPYP00000017359 | orthology | Orangutan |
| RGD1559914_predicted | orthology | Rat |
| Q8R4U8_RAT | orthology | Rat |
| NLRC4 | paralogy | Chimpanzee |
| NLRC4 | paralogy | Chimpanzee |
| IPI00708553.3 | paralogy | Cow |
| IPI00708553.3 | paralogy | Cow |
| NLRC4 | paralogy | Horse |
| NLRC4 | paralogy | Horse |
| NLRC4 | paralogy | Human |
| NLRC4 | paralogy | Human |
| AC140134.2 | paralogy | Human |
| AC140134.1 | paralogy | Human |
| NLRC4 | paralogy | Lyzard |
| NLRC4 | paralogy | Lyzard |
| NLRC4 | paralogy | Macaca |
| NLRC4 | paralogy | Macaca |
| Nlrc4 | paralogy | Mouse |
| Nlrc4 | paralogy | Mouse |
| NLRC4 | paralogy | Orangutan |
| NLRC4 | paralogy | Orangutan |
| Nlrc4 | paralogy | Rat |
| NP_001100177.1 | paralogy | Rat |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006916 | anti-apoptosis | biological_proccess | TAS |
| GO:0007399 | nervous system development | biological_proccess | TAS |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0006952 | defense response | biological_proccess | IEA |
| GO:0000166 | nucleotide binding | mollecular_function | IEA |
| GO:0017111 | nucleoside-triphosphatase activity | mollecular_function | IEA |
| GO:0008270 | zinc ion binding | mollecular_function | IEA |
| GO:0046872 | metal ion binding | mollecular_function | IEA |
| GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :7634
- Gene related info from GeneCards [?] : BIRC1
- Ensembl genome browser [?] : ENSG00000081770
- Expression info from Arrayexpress [?] : ENSG00000081770
- Protein expression from Protein Atlas: [?] ENSG00000081770
- Community gene edition from Wikigenes: [?] 4671
Click on [?] for more information.


