CSK (Homo sapiens)
Description [+]
- Synonyms: CSK
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tyrosine-protein kinase CSK (EC 2.7.10.2)(C-SRC kinase)(Protein-tyrosine kinase CYL) [Source:UniProtKB/Swiss-Prot;Acc:P41240]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CSK-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | SH3_1 | 12 | 68 |
PFAM A | SH3_2 | 13 | 68 |
PFAM A | SH2 | 82 | 156 |
PFAM A | Pkinase | 195 | 440 |
PFAM A | Pkinase_Tyr | 195 | 440 |
Protein sequence [+]
CSK | Homo sapiens | 9606 | length:450
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
Structure links:
- Smartdomain prediction information: SM00326
- Smartdomain prediction information: SM00252
- Smartdomain prediction information: SM00219
- Smartdomain prediction information: SM00220
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS00109
- Profile motif and domain profile information: PS50001
- Profile motif and domain profile information: PS50002
- Profile motif and domain profile information: PS50011
- Interpro domain information: P41240
- PFAM domain and domain family information: P41240
- Protein 3D structures from PDB: 1BYG
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0006468 | protein amino acid phosphorylation | biological_proccess | TAS |
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0004715 | non-membrane spanning protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0008022 | protein C-terminus binding | mollecular_function | TAS |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | TAS |
GO:0005886 | plasma membrane | cell_component | EXP |
GO:0005911 | cell-cell junction | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :2444
- Gene related info from GeneCards [?] : CSK
- Ensembl genome browser [?] : ENSG00000103653
- Expression info from Arrayexpress [?] : ENSG00000103653
- Protein expression from Protein Atlas: [?] ENSG00000103653
- Community gene edition from Wikigenes: [?] 1445
- OMIM gene information: 124095
- OMIM disease information:
- entrezgene: 1445
- refseq_dna: NM_004383
- refseq_dna: NM_001127190
- refseq_peptide: NP_001120662
- refseq_peptide: NP_004374
Click on [?] for more information.