MAPK14 (Homo sapiens)
Description [+]
- Synonyms: MAPK14
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Mitogen-activated protein kinase 14 (EC 2.7.11.24)(Mitogen-activated protein kinase p38 alpha)(MAP kinase p38 alpha)(Cytokine suppressive anti-inflammatory drug-binding protein)(CSAID-binding protein)(CSBP)(MAX-interacting protein 2)(MAP kinase MXI2)(SAPK2A) [Source:UniProtKB/Swiss-Prot;Acc:Q16539]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAPK14-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 24 | 308 |
PFAM A | Pkinase_Tyr | 24 | 250 |
Protein sequence [+]
MAPK14 | Homo sapiens | 9606 | length:360
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Structure links:
- Smartdomain prediction information: SM00219
- Smartdomain prediction information: SM00220
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS01351
- Profile motif and domain profile information: PS50011
- Interpro domain information: Q16539
- PFAM domain and domain family information: Q16539
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0000077 | DNA damage checkpoint | biological_proccess | IEA |
GO:0002062 | chondrocyte differentiation | biological_proccess | IEA |
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0019395 | fatty acid oxidation | biological_proccess | IEA |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0032495 | response to muramyl dipeptide | biological_proccess | IEA |
GO:0045648 | positive regulation of erythrocyte differentiation | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0006935 | chemotaxis | biological_proccess | TAS |
GO:0006928 | cell motion | biological_proccess | TAS |
GO:0007265 | Ras protein signal transduction | biological_proccess | EXP |
GO:0006950 | response to stress | biological_proccess | IDA |
GO:0001525 | angiogenesis | biological_proccess | IEA |
GO:0007519 | skeletal muscle development | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0007243 | protein kinase cascade | biological_proccess | IDA |
GO:0006950 | response to stress | biological_proccess | IEA |
GO:0000902 | cell morphogenesis | biological_proccess | IEA |
GO:0007243 | protein kinase cascade | biological_proccess | IEA |
GO:0046777 | protein amino acid autophosphorylation | biological_proccess | IEA |
GO:0051403 | stress-activated MAPK cascade | biological_proccess | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004708 | MAP kinase kinase activity | mollecular_function | TAS |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0008339 | MP kinase activity | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0008022 | protein C-terminus binding | mollecular_function | IEA |
GO:0000922 | spindle pole | cell_component | IEA |
GO:0005623 | cell | cell_component | IEA |
GO:0005654 | nucleoplasm | cell_component | EXP |
GO:0005829 | cytosol | cell_component | EXP |
GO:0005634 | nucleus | cell_component | ISS |
GO:0005737 | cytoplasm | cell_component | ISS |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005625 | soluble fraction | cell_component | IEA |
GO:0044445 | cytosolic part | cell_component | IEA |
Check GO Evidence Codes here
miRNAs [+]
miRNA | Regulation | Description | Pubmed |
---|---|---|---|
hsa-miR-124 | overexpression by mature miRNA transfection | miR-1 or miR-124 RNA duplexes were transfected into HeLa cells, and mRNA was purified and profiled on microarrays (Fig. 1a). Filtering the expression profiles for genes characterized by the LocusLink database12 that were significantly downregulated (P , 0.001) at both 12 and 24 h, gave sets of 96 and 174 annotated genes downregulated by miR-1 and miR-124, respectively (Supplementary Tables 1 and 2). | Ref. |
hsa-miR-24 | Ref. |
Information from other databases [+]
- Gene info from HGNC [?] :6876
- Gene related info from GeneCards [?] : MAPK14
- Ensembl genome browser [?] : ENSG00000112062
- Expression info from Arrayexpress [?] : ENSG00000112062
- Protein expression from Protein Atlas: [?] ENSG00000112062
- Community gene edition from Wikigenes: [?] 1432
- OMIM gene information: 600289
- OMIM disease information:
Click on [?] for more information.