TNFSF14 (Homo sapiens)
Description [+]
- Synonyms: TNFSF14
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor ligand superfamily member 14 (Herpesvirus entry mediator-ligand)(HVEM-L)(CD258 antigen) [Contains Tumor necrosis factor ligand superfamily member 14, membrane form;Tumor necrosis factor ligand superfamily member 14, soluble form] [Source:UniProtKB/Swiss-Prot;Acc:O43557]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFSF14-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 112 | 240 |
Protein sequence [+]
TNFSF14 | Homo sapiens | 9606 | length:240
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQ
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL
AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELL
VSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL
AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELL
VSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0031295 | T cell costimulation | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | TAS |
GO:0042098 | T cell proliferation | biological_proccess | NAS |
GO:0008588 | release of cytoplasmic sequestered NF-kappaB | biological_proccess | IDA |
GO:0007165 | signal transduction | biological_proccess | NAS |
GO:0043029 | T cell homeostasis | biological_proccess | NAS |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0043027 | caspase inhibitor activity | mollecular_function | IDA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :11930
- Gene related info from GeneCards [?] : TNFSF14
- Ensembl genome browser [?] : ENSG00000125735
- Expression info from Arrayexpress [?] : ENSG00000125735
- Protein expression from Protein Atlas: [?] ENSG00000125735
- Community gene edition from Wikigenes: [?] 8740
- OMIM gene information: 604520
- OMIM disease information:
Click on [?] for more information.