ANXA1 (Homo sapiens)
Description [+]
- Synonyms: ANXA1, ANX1, LPC1, ANNEXIN-1, LIPOCORTIN I
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Annexin A1 (Annexin-1)(Annexin I)(Lipocortin I)(Calpactin II)(Chromobindin-9)(p35)(Phospholipase A2 inhibitory protein) [Source:UniProtKB/Swiss-Prot;Acc:P04083]
- Family: other
- Process: apoptosis,
- Pathways: apoptotic cell clearance,
- Criteria: manually curated
- Curator comment: Null
- Mouse ortholog(s): Anxa1
- WIKI: ANXA1-H_sapiens
References [+]
- Annexin-1 and peptide derivatives are released by apoptotic cells and stimulate phagocytosis of apoptotic neutrophils by macrophages.
- Scannell M, Flanagan MB, deStefani A, Wynne KJ, Cagney G, Godson C, Maderna P
- The resolution of inflammation is a dynamically regulated process that may be subverted in many pathological conditions. Macrophage (Mphi) phagocytic clearance of apoptotic leukocytes plays an important role in the resolution of inflammation as this process prevents the exposure of tissues at the inflammatory site to the noxious contents of lytic cells. It is increasingly appreciated that endogenously produced mediators, such as lipoxins, act as potent regulators (nanomolar range) of the phagocytic clearance of apoptotic cells. In this study, we have investigated the intriguing possibility that apoptotic cells release signals that promote their clearance by phagocytes. We report that conditioned medium from apoptotic human polymorphonuclear neutrophils (PMN), Jurkat T lymphocytes, and human mesangial cells promote phagocytosis of apoptotic PMN by Mphi and THP-1 cells differentiated to a Mphi-like phenotype. This prophagocytic activity appears to be dose dependent, sensitive to the caspase inhibitor zVAD-fmk, and is associated with actin rearrangement and release of TGF-beta1, but not IL-8. The prophagocytic effect can be blocked by the formyl peptide receptor antagonist Boc2, suggesting that the prophagocytic factor(s) may interact with the lipoxin A(4) receptor, FPRL-1. Using nanoelectrospray liquid chromatography mass spectrometry and immunodepletion and immunoneutralization studies, we have ascertained that annexin-1 and peptide derivatives are putative prophagocytic factors released by apoptotic cells that promote phagocytosis of apoptotic PMN by M[phi] and differentiated THP-1 cells. These data highlight the role of annexin-1 and peptide derivatives in promoting the resolution of inflammation and expand on the therapeutic anti-inflammatory potential of annexin-1. J Immunol. 2007 Apr 1;178(7):4595-605.
- Apoptosis: controlled demolition at the cellular level.
- Taylor RC, Cullen SP, Martin SJ
- Apoptosis is characterized by a series of dramatic perturbations to the cellular architecture that contribute not only to cell death, but also prepare cells for removal by phagocytes and prevent unwanted immune responses. Much of what happens during the demolition phase of apoptosis is orchestrated by members of the caspase family of cysteine proteases. These proteases target several hundred proteins for restricted proteolysis in a controlled manner that minimizes damage and disruption to neighbouring cells and avoids the release of immunostimulatory molecules. Nat Rev Mol Cell Biol. 2008 Mar;9(3):231-41.
- References from Mouse ortholog(s):
- The annexin-1 knockout mouse: what it tells us about the inflammatory response.
- Roviezzo F, Getting SJ, Paul-Clark MJ, Yona S, Gavins FN, Perretti M, Hannon R, Croxtall JD, Buckingham JC, Flower RJ
- The 37kDa protein annexin 1 (Anx-1; lipocortin 1) is a glucocorticoid-regulated protein that has been implicated in the regulation of phagocytosis, cell signalling and proliferation, and postulated to be a mediator of glucocorticoids action in inflammation and in the control of anterior pituitary hormone release. Immuno-neutralisation or antisense strategies support this hypothesis as they can reverse the effect of glucocorticoids in several systems. We recently generated a line of mice lacking the Anx-1 gene noting that some tissues taken from such animals exhibited an increased expression of several proteins including COX-2 and cPLA2. In models of experimental inflammation, Anx-1(-/-) mice exhibit an exaggerated response and a partial or complete resistance to the anti-inflammatory effects of glucocorticoids. Several other anomalies were noted including abnormal leukocyte adhesion molecule expression, an increased spontaneous migratory behaviour of PMN in Anx-1(-/-) mice and a resistance in Anx-1(-/-) macrophages to glucocorticoid inhibition of superoxide generation. This paper reviews these and other data in the light of the development of the 'second messenger' hypothesis of glucocorticoid action. J Physiol Pharmacol. 2002 Dec;53(4 Pt 1):541-53.
- Apoptosis: controlled demolition at the cellular level.
- Taylor RC, Cullen SP, Martin SJ
- Apoptosis is characterized by a series of dramatic perturbations to the cellular architecture that contribute not only to cell death, but also prepare cells for removal by phagocytes and prevent unwanted immune responses. Much of what happens during the demolition phase of apoptosis is orchestrated by members of the caspase family of cysteine proteases. These proteases target several hundred proteins for restricted proteolysis in a controlled manner that minimizes damage and disruption to neighbouring cells and avoids the release of immunostimulatory molecules. Nat Rev Mol Cell Biol. 2008 Mar;9(3):231-41.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Annexin | 46 | 111 |
| PFAM A | Annexin | 118 | 183 |
| PFAM A | Annexin | 201 | 267 |
| PFAM A | Annexin | 277 | 342 |
Protein sequence [+]
ANXA1 | Homo sapiens | 9606 | length:346
MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGV
DEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDA
DELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNAL
LSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKY
TKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIM
VSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN
DEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDA
DELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNAL
LSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKY
TKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIM
VSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| ANXA1_CHICK | orthology | Chicken |
| ANXA1_PANTR | orthology | Chimpanzee |
| ANXA1_BOVIN | orthology | Cow |
| Q6JDN3_CANFA | orthology | Dog |
| ANXA1 (2 of 2) | orthology | Fugu |
| ANXA1 (1 of 2) | orthology | Fugu |
| ANXA1 (1 of 2) | orthology | Gasterosteus |
| ANXA1 (2 of 2) | orthology | Gasterosteus |
| ANXA1 | orthology | Gorilla |
| ANXA1_HORSE | orthology | Horse |
| XP_001917046.1 | orthology | Horse |
| ANXA1 | orthology | Lyzard |
| ANXA1 | orthology | Macaca |
| ANXA1 (2 of 2) | orthology | Medaka |
| O93446_ORYLA | orthology | Medaka |
| ANXA1 | orthology | Monodelphis |
| Anxa1 | orthology | Mouse |
| ANXA1_PONPY | orthology | Orangutan |
| ANXA1 | orthology | Ornithorhynchus |
| ANXA1_RABIT | orthology | Rabbit |
| ANXA1_RAT | orthology | Rat |
| ANXA1 (1 of 2) | orthology | Tetraodon |
| BC087822.1 | orthology | Xenopus |
| ANXA1 | orthology | Zebra finch |
| anxa1a | orthology | Zebrafish |
| anxa1b | orthology | Zebrafish |
| anxa1c | orthology | Zebrafish |
| zgc:110283 | orthology | Zebrafish |
| A_aegypti_AAEL005417-PA | paralogy | Aedes |
| ANXA2_CHICK | paralogy | Chicken |
| ANXA5_CHICK | paralogy | Chicken |
| IPI00596627.4 | paralogy | Chicken |
| ANXA6_CHICK | paralogy | Chicken |
| NP_001012921.1 | paralogy | Chicken |
| XR_024382.1 | paralogy | Chimpanzee |
| ANXA4 | paralogy | Chimpanzee |
| ANXA7 | paralogy | Chimpanzee |
| XM_001155090.1 | paralogy | Chimpanzee |
| ANXA6 | paralogy | Chimpanzee |
| ANXA3 | paralogy | Chimpanzee |
| NA | paralogy | Ciona |
| ANXA7_BOVIN | paralogy | Cow |
| ANXA3_BOVIN | paralogy | Cow |
| ANXA6_BOVIN | paralogy | Cow |
| ANXA4_BOVIN | paralogy | Cow |
| ANXA2_BOVIN | paralogy | Cow |
| ANXA2_CANFA | paralogy | Dog |
| ANXA7 | paralogy | Dog |
| C_familiaris_ENSCAFP00000003127 | paralogy | Dog |
| ANXA3 | paralogy | Dog |
| ANXA11 | paralogy | Dog |
| ANXA2 (2 of 2) | paralogy | Fugu |
| ANXA11 (1 of 2) | paralogy | Fugu |
| ANXA2 (1 of 2) | paralogy | Fugu |
| ANXA5 (1 of 2) | paralogy | Fugu |
| ANXA11 (2 of 2) | paralogy | Fugu |
| ANXA11 (1 of 2) | paralogy | Gasterosteus |
| ANXA4 | paralogy | Gasterosteus |
| ANXA5 (1 of 2) | paralogy | Gasterosteus |
| ANXA2 (1 of 2) | paralogy | Gasterosteus |
| ANXA2 (2 of 2) | paralogy | Gasterosteus |
| G_gorilla_ENSGGOP00000005013 | paralogy | Gorilla |
| ANXA11 | paralogy | Gorilla |
| XP_001500744.1 | paralogy | Horse |
| ANXA3 | paralogy | Horse |
| ANXA11 | paralogy | Horse |
| B2B9I8_HORSE | paralogy | Horse |
| ANXA6 | paralogy | Horse |
| ANXA4 | paralogy | Horse |
| ANXA7 | paralogy | Horse |
| ANXA11 | paralogy | Human |
| ANXA2 | paralogy | Human |
| ANXA6 | paralogy | Human |
| ANXA7 | paralogy | Human |
| ANXA4 | paralogy | Human |
| ANXA3 | paralogy | Human |
| ANXA11 | paralogy | Lyzard |
| A_carolinensis_ENSACAP00000009701 | paralogy | Lyzard |
| ANXA3 | paralogy | Lyzard |
| ANXA2 | paralogy | Lyzard |
| ANXA7 | paralogy | Lyzard |
| ANXA6 | paralogy | Macaca |
| ANXA11 | paralogy | Macaca |
| Q7M2V1_MACMU | paralogy | Macaca |
| ANXA2 | paralogy | Macaca |
| ANXA4 | paralogy | Macaca |
| M_mulatta_ENSMMUP00000025230 | paralogy | Macaca |
| ANXA3 | paralogy | Macaca |
| ANXA6 | paralogy | Medaka |
| O93447_ORYLA | paralogy | Medaka |
| ANXA2 (1 of 2) | paralogy | Medaka |
| ANXA11 (2 of 2) | paralogy | Medaka |
| O93444_ORYLA | paralogy | Medaka |
| ANXA13 (1 of 2) | paralogy | Medaka |
| ANXA4 | paralogy | Monodelphis |
| ANXA2 | paralogy | Monodelphis |
| ANXA11 | paralogy | Monodelphis |
| ANXA3 | paralogy | Monodelphis |
| XM_001371763.1 | paralogy | Monodelphis |
| ANXA7 | paralogy | Monodelphis |
| Anxa6 | paralogy | Mouse |
| Anxa3 | paralogy | Mouse |
| Anxa11 | paralogy | Mouse |
| Anxa4 | paralogy | Mouse |
| Anxa7 | paralogy | Mouse |
| Anxa2 | paralogy | Mouse |
| ANXA3 | paralogy | Orangutan |
| ANXA2_PONPY | paralogy | Orangutan |
| ANXA7 | paralogy | Orangutan |
| ANXA4 | paralogy | Orangutan |
| ANXA6 | paralogy | Orangutan |
| ANXA11 | paralogy | Orangutan |
| ANXA2 | paralogy | Ornithorhynchus |
| ANXA7 | paralogy | Ornithorhynchus |
| O_anatinus_ENSOANP00000016920 | paralogy | Ornithorhynchus |
| ANXA4_RAT | paralogy | Rat |
| ANXA3_RAT | paralogy | Rat |
| ANXA6_RAT | paralogy | Rat |
| ANXA2_RAT | paralogy | Rat |
| NP_569100.2 | paralogy | Rat |
| NP_001011918.1 | paralogy | Rat |
| ANXA2 (2 of 2) | paralogy | Tetraodon |
| ANXA4 | paralogy | Tetraodon |
| ANXA5 (2 of 2) | paralogy | Tetraodon |
| ANXA6 | paralogy | Tetraodon |
| ANXA2 (1 of 2) | paralogy | Tetraodon |
| ANXA11 (2 of 3) | paralogy | Tetraodon |
| ANXA11 (3 of 3) | paralogy | Tetraodon |
| ANXA5 (1 of 2) | paralogy | Tetraodon |
| ANXA11 (1 of 3) | paralogy | Tetraodon |
| ANXA3 | paralogy | Xenopus |
| anxa7 | paralogy | Xenopus |
| anxa2 | paralogy | Xenopus |
| TGas115l10.1 | paralogy | Xenopus |
| anxa4 | paralogy | Xenopus |
| ANXA6 | paralogy | Zebra finch |
| ANXA5 | paralogy | Zebra finch |
| ANXA2 | paralogy | Zebra finch |
| ANXA11 | paralogy | Zebra finch |
| ANXA7 | paralogy | Zebra finch |
| anxa3a | paralogy | Zebrafish |
| anxa4 | paralogy | Zebrafish |
| anxa2a | paralogy | Zebrafish |
| anxa3b | paralogy | Zebrafish |
| anxa5b | paralogy | Zebrafish |
| anxa11b | paralogy | Zebrafish |
| anxa2b | paralogy | Zebrafish |
| anxa5a | paralogy | Zebrafish |
| anxa11a | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0007010 | cytoskeleton organization | biological_proccess | IEA |
| GO:0007049 | cell cycle | biological_proccess | IEA |
| GO:0050482 | arachidonic acid secretion | biological_proccess | IEA |
| GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
| GO:0006928 | cell motion | biological_proccess | TAS |
| GO:0006954 | inflammatory response | biological_proccess | TAS |
| GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | TAS |
| GO:0006629 | lipid metabolic process | biological_proccess | TAS |
| GO:0006916 | anti-apoptosis | biological_proccess | TAS |
| GO:0018149 | peptide cross-linking | biological_proccess | IDA |
| GO:0030216 | keratinocyte differentiation | biological_proccess | IDA |
| GO:0050819 | negative regulation of coagulation | biological_proccess | IEA |
| GO:0007165 | signal transduction | biological_proccess | IEA |
| GO:0005509 | calcium ion binding | mollecular_function | IEA |
| GO:0005544 | calcium-dependent phospholipid binding | mollecular_function | IEA |
| GO:0004859 | phospholipase inhibitor activity | mollecular_function | IEA |
| GO:0005102 | receptor binding | mollecular_function | TAS |
| GO:0005509 | calcium ion binding | mollecular_function | TAS |
| GO:0019834 | phospholipase A2 inhibitor activity | mollecular_function | IEA |
| GO:0005198 | structural molecule activity | mollecular_function | IDA |
| GO:0030674 | protein binding, bridging | mollecular_function | IDA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0042383 | sarcolemma | cell_component | IEA |
| GO:0005634 | nucleus | cell_component | IEA |
| GO:0005929 | cilium | cell_component | IEA |
| GO:0016323 | basolateral plasma membrane | cell_component | IEA |
| GO:0005737 | cytoplasm | cell_component | TAS |
| GO:0001533 | cornified envelope | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSG00000135046
- Expression info from Arrayexpress [?] : ENSG00000135046
- Protein expression from Protein Atlas: [?] ENSG00000135046
Click on [?] for more information.
