PRDX1 (Homo sapiens)
Description [+]
- Synonyms: PRDX1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Peroxiredoxin-1 (EC 1.11.1.15)(Thioredoxin peroxidase 2)(Thioredoxin-dependent peroxide reductase 2)(Proliferation-associated gene protein)(PAG)(Natural killer cell-enhancing factor A)(NKEF-A) [Source:UniProtKB/Swiss-Prot;Acc:Q06830]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX1-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Redoxin | 7 | 163 |
PFAM A | AhpC-TSA | 8 | 142 |
PFAM A | 1-cysPrx_C | 152 | 195 |
Protein sequence [+]
PRDX1 | Homo sapiens | 9606 | length:199
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK
DRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0045454 | cell redox homeostasis | biological_proccess | IEA |
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | IDA |
GO:0001501 | skeletal system development | biological_proccess | TAS |
GO:0008283 | cell proliferation | biological_proccess | TAS |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IEA |
GO:0000302 | response to reactive oxygen species | biological_proccess | IEA |
GO:0019430 | removal of superoxide radicals | biological_proccess | IEA |
GO:0034101 | erythrocyte homeostasis | biological_proccess | IEA |
GO:0032872 | regulation of stress-activated MAPK cascade | biological_proccess | IEA |
GO:0042267 | natural killer cell mediated cytotoxicity | biological_proccess | IEA |
GO:0042345 | regulation of NF-kappaB import into nucleus | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0051920 | peroxiredoxin activity | mollecular_function | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0042470 | melanosome | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :9352
- Gene related info from GeneCards [?] : PRDX1
- Ensembl genome browser [?] : ENSG00000117450
- Expression info from Arrayexpress [?] : ENSG00000117450
- Protein expression from Protein Atlas: [?] ENSG00000117450
- Community gene edition from Wikigenes: [?] 5052
- OMIM gene information: 176763
- OMIM disease information:
Click on [?] for more information.