MUL1 (Homo sapiens)
Description [+]
- Synonyms: MUL1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Mitochondrial ubiquitin ligase activator of NFKB 1 (EC 6.3.2.-)(E3 ubiquitin-protein ligase MUL1)(Growth inhibition and death E3 ligase)(Putative NF-kappa-B-activating protein 266)(Mitochondrial-anchored protein ligase)(RING finger protein 218) [Source:UniProtKB/Swiss-Prot;Acc:Q969V5]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MUL1-H_sapiens
Structure & Sequence [+]
Protein sequence [+]
MUL1 | Homo sapiens | 9606 | length:352
MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKVHLGEDLKSILSEAPG
KCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQR
TNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPK
GIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLW
KVLALVFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQEHEAQLLSRAKPEDRESLKS
ACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLYNS
KCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQR
TNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPK
GIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLW
KVLALVFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQEHEAQLLSRAKPEDRESLKS
ACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLYNS
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0019941 | modification-dependent protein catabolic process | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IMP |
GO:0006919 | activation of caspase activity | biological_proccess | IDA |
GO:0051646 | mitochondrion localization | biological_proccess | IMP |
GO:0016567 | protein ubiquitination | biological_proccess | IDA |
GO:0007257 | activation of JUN kinase activity | biological_proccess | IDA |
GO:0006917 | induction of apoptosis | biological_proccess | IDA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IDA |
GO:0000266 | mitochondrial fission | biological_proccess | IMP |
GO:0016874 | ligase activity | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0004871 | signal transducer activity | mollecular_function | IMP |
GO:0042802 | identical protein binding | mollecular_function | IPI |
GO:0004842 | ubiquitin-protein ligase activity | mollecular_function | IDA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005741 | mitochondrial outer membrane | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0031307 | integral to mitochondrial outer membrane | cell_component | IDA |
GO:0005777 | peroxisome | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :25762
- Gene related info from GeneCards [?] : MUL1
- Ensembl genome browser [?] : ENSG00000090432
- Expression info from Arrayexpress [?] : ENSG00000090432
- Protein expression from Protein Atlas: [?] ENSG00000090432
- Community gene edition from Wikigenes: [?] 79594
- OMIM gene information: 612037
- OMIM disease information:
Click on [?] for more information.