ICAM1 (Homo sapiens)
Description [+]
- Synonyms: ICAM1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Intercellular adhesion molecule 1 Precursor (ICAM-1)(Major group rhinovirus receptor)(CD54 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P05362]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ICAM1-H_sapiens
Structure & Sequence [+]
Protein sequence [+]
ICAM1 | Homo sapiens | 9606 | length:532
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0016337 | cell-cell adhesion | biological_proccess | IEA |
GO:0022614 | membrane to membrane docking | biological_proccess | IEP |
GO:0050900 | leukocyte migration | biological_proccess | IEP |
GO:0002457 | T cell antigen processing and presentation | biological_proccess | IEA |
GO:0007159 | leukocyte adhesion | biological_proccess | IEA |
GO:0033627 | cell adhesion mediated by integrin | biological_proccess | IEA |
GO:0002693 | positive regulation of cellular extravasation | biological_proccess | IMP |
GO:0007157 | heterophilic cell adhesion | biological_proccess | TAS |
GO:0002291 | T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell | biological_proccess | IMP |
GO:0046813 | virion attachment, binding of host cell surface receptor | biological_proccess | IDA |
GO:0051856 | adhesion to symbiont | biological_proccess | IDA |
GO:0001910 | regulation of leukocyte mediated cytotoxicity | biological_proccess | TAS |
GO:0030155 | regulation of cell adhesion | biological_proccess | IEA |
GO:0044419 | interspecies interaction between organisms | biological_proccess | IEA |
GO:0045429 | positive regulation of nitric oxide biosynthetic process | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0007155 | cell adhesion | biological_proccess | IEA |
GO:0005178 | integrin binding | mollecular_function | IPI |
GO:0004888 | transmembrane receptor activity | mollecular_function | TAS |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0005178 | integrin binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IDA |
GO:0001772 | immunological synapse | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | NAS |
GO:0005887 | integral to plasma membrane | cell_component | TAS |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0009986 | cell surface | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSG00000090339
- Expression info from Arrayexpress [?] : ENSG00000090339
- Protein expression from Protein Atlas: [?] ENSG00000090339
Click on [?] for more information.