AIF (Homo sapiens)
Description [+]
- Synonyms: AIF, AIF, AIFM1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Apoptosis-inducing factor 1, mitochondrial Precursor (EC 1.-.-.-)(Programmed cell death protein 8)
- Family: Other
- Process: cell death (other),
- Pathways: undefined,
- Criteria: manually curated
- Curator comment: The role of this protein during cell death requires further clarification
- Mouse ortholog(s): Aifm1
- WIKI: AIF-H_sapiens
References [+]
- Molecular characterization of mitochondrial apoptosis-inducing factor.
- Susin SA, Lorenzo HK, Zamzami N, Marzo I, Snow BE, Brothers GM, Mangion J, Jacotot E, Costantini P, Loeffler M, Larochette N, Goodlett DR, Aebersold R, Siderovski DP, Penninger JM, Kroemer G
- Mitochondria play a key part in the regulation of apoptosis (cell death). Their intermembrane space contains several proteins that are liberated through the outer membrane in order to participate in the degradation phase of apoptosis. Here we report the identification and cloning of an apoptosis-inducing factor, AIF, which is sufficient to induce apoptosis of isolated nuclei. AIF is a flavoprotein of relative molecular mass 57,000 which shares homology with the bacterial oxidoreductases; it is normally confined to mitochondria but translocates to the nucleus when apoptosis is induced. Recombinant AIF causes chromatin condensation in isolated nuclei and large-scale fragmentation of DNA. It induces purified mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Microinjection of AIF into the cytoplasm of intact cells induces condensation of chromatin, dissipation of the mitochondrial transmembrane potential, and exposure of phosphatidylserine in the plasma membrane. None of these effects is prevented by the wide-ranging caspase inhibitor known as Z-VAD.fmk. Overexpression of Bcl-2, which controls the opening of mitochondrial permeability transition pores, prevents the release of AIF from the mitochondrion but does not affect its apoptogenic activity. These results indicate that AIF is a mitochondrial effector of apoptotic cell death. Nature. 1999 Feb 4;397(6718):441-6.
- AIF deficiency compromises oxidative phosphorylation.
- Vahsen N, Cande C, Briere JJ, Benit P, Joza N, Larochette N, Mastroberardino PG, Pequignot MO, Casares N, Lazar V, Feraud O, Debili N, Wissing S, Engelhardt S, Madeo F, Piacentini M, Penninger JM, Schagger H, Rustin P, Kroemer G
- Apoptosis-inducing factor (AIF) is a mitochondrial flavoprotein that, after apoptosis induction, translocates to the nucleus where it participates in apoptotic chromatinolysis. Here, we show that human or mouse cells lacking AIF as a result of homologous recombination or small interfering RNA exhibit high lactate production and enhanced dependency on glycolytic ATP generation, due to severe reduction of respiratory chain complex I activity. Although AIF itself is not a part of complex I, AIF-deficient cells exhibit a reduced content of complex I and of its components, pointing to a role of AIF in the biogenesis and/or maintenance of this polyprotein complex. Harlequin mice with reduced AIF expression due to a retroviral insertion into the AIF gene also manifest a reduced oxidative phosphorylation (OXPHOS) in the retina and in the brain, correlating with reduced expression of complex I subunits, retinal degeneration, and neuronal defects. Altogether, these data point to a role of AIF in OXPHOS and emphasize the dual role of AIF in life and death. EMBO J. 2004 Nov 24;23(23):4679-89. Epub 2004 Nov 4.
- References from Mouse ortholog(s):
- Loss of Aif function causes cell death in the mouse embryo, but the temporal progression of patterning is normal.
- Brown D, Yu BD, Joza N, Benit P, Meneses J, Firpo M, Rustin P, Penninger JM, Martin GR
- Apoptosis-inducing factor (AIF) is an evolutionarily conserved, ubiquitously expressed flavoprotein with NADH oxidase activity that is normally confined to mitochondria. In mammalian cells, AIF is released from mitochondria in response to apoptotic stimuli and translocates to the nucleus where it is thought to bind DNA and contribute to chromatinolysis and cell death in a caspase-independent manner. Here we describe the consequences of inactivating Aif in the early mouse embryo. Unexpectedly, we found that both the apoptosis-dependent process of cavitation in embryoid bodies and apoptosis associated with embryonic neural tube closure occur in the absence of AIF, indicating that Aif function is not required for apoptotic cell death in early mouse embryos. By embryonic day 9 (E9), loss of Aif function causes abnormal cell death, presumably because of reduced mitochondrial respiratory chain complex I activity. Because of this cell death, Aif null embryos fail to increase significantly in size after E9. Remarkably, patterning processes continue on an essentially normal schedule, such that E10 Aif null embryos with only approximately 1/10 the normal number of cells have the same somite number as their wild-type littermates. These observations show that pattern formation in the mouse can occur independent of embryo size and cell number. Proc Natl Acad Sci U S A. 2006 Jun 27;103(26):9918-23. Epub 2006 Jun 20.
- AIF deficiency compromises oxidative phosphorylation.
- Vahsen N, Cande C, Briere JJ, Benit P, Joza N, Larochette N, Mastroberardino PG, Pequignot MO, Casares N, Lazar V, Feraud O, Debili N, Wissing S, Engelhardt S, Madeo F, Piacentini M, Penninger JM, Schagger H, Rustin P, Kroemer G
- Apoptosis-inducing factor (AIF) is a mitochondrial flavoprotein that, after apoptosis induction, translocates to the nucleus where it participates in apoptotic chromatinolysis. Here, we show that human or mouse cells lacking AIF as a result of homologous recombination or small interfering RNA exhibit high lactate production and enhanced dependency on glycolytic ATP generation, due to severe reduction of respiratory chain complex I activity. Although AIF itself is not a part of complex I, AIF-deficient cells exhibit a reduced content of complex I and of its components, pointing to a role of AIF in the biogenesis and/or maintenance of this polyprotein complex. Harlequin mice with reduced AIF expression due to a retroviral insertion into the AIF gene also manifest a reduced oxidative phosphorylation (OXPHOS) in the retina and in the brain, correlating with reduced expression of complex I subunits, retinal degeneration, and neuronal defects. Altogether, these data point to a role of AIF in OXPHOS and emphasize the dual role of AIF in life and death. EMBO J. 2004 Nov 24;23(23):4679-89. Epub 2004 Nov 4.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Pyr_redox_2 | 133 | 444 |
| PFAM A | Pyr_redox | 302 | 399 |
Protein sequence [+]
AIF | Homo sapiens | 9606 | length:613
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEG
EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE
ITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
GGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEG
EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE
ITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| A_aegypti_AAEL002016-PA | orthology | Aedes |
| A_gambiae_AGAP008044-PA | orthology | Anopheles |
| NP_001007491.1 | orthology | Chicken |
| AIFM1 | orthology | Chimpanzee |
| C_intestinalis_ENSCINP00000012225 | orthology | Ciona |
| IPI00712659.1 | orthology | Cow |
| AIFM1 | orthology | Dog |
| CG7263 | orthology | Fly |
| AIFM1 | orthology | Fugu |
| AIFM1 | orthology | Gasterosteus |
| AIFM1 | orthology | Gorilla |
| AIFM1 | orthology | Horse |
| AIFM1 | orthology | Lyzard |
| AIFM1 | orthology | Macaca |
| AIFM1 | orthology | Medaka |
| AIFM1 | orthology | Monodelphis |
| Aifm1 | orthology | Mouse |
| AIFM1 | orthology | Orangutan |
| AIFM1 | orthology | Ornithorhynchus |
| AIFM1 | orthology | Rabbit |
| Pdcd8 | orthology | Rat |
| AIFM1 | orthology | Tetraodon |
| wah-1 | orthology | Worm |
| pdcd8 | orthology | Xenopus |
| T_guttata_ENSTGUP00000005365 | orthology | Zebra finch |
| T_guttata_ENSTGUP00000016816 | orthology | Zebra finch |
| pdcd8 | orthology | Zebrafish |
| A_aegypti_AAEL011158-PA | paralogy | Aedes |
| G_gallus_ENSGALP00000039047 | paralogy | Chicken |
| AIFM3 | paralogy | Chicken |
| AIFM3 | paralogy | Chimpanzee |
| C_intestinalis_ENSCINP00000015763 | paralogy | Ciona |
| Q2KJ59_BOVIN | paralogy | Cow |
| CG10700 | paralogy | Fly |
| CG4199 | paralogy | Fly |
| T_rubripes_ENSTRUP00000030429 | paralogy | Fugu |
| AIFM3 | paralogy | Fugu |
| T_rubripes_ENSTRUP00000040612 | paralogy | Fugu |
| G_aculeatus_ENSGACP00000027082 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000011210 | paralogy | Gasterosteus |
| AIFM3 | paralogy | Gasterosteus |
| AIFM3 | paralogy | Human |
| AIFM3 | paralogy | Lyzard |
| A_carolinensis_ENSACAP00000014484 | paralogy | Lyzard |
| AIFM3 | paralogy | Macaca |
| O_latipes_ENSORLP00000003241 | paralogy | Medaka |
| O_latipes_ENSORLP00000010037 | paralogy | Medaka |
| AIFM3 | paralogy | Medaka |
| Aifm3 | paralogy | Mouse |
| AIFM3 | paralogy | Orangutan |
| RGD1306028 | paralogy | Rat |
| AIFM3 | paralogy | Tetraodon |
| T_nigroviridis_ENSTNIP00000019217 | paralogy | Tetraodon |
| T_nigroviridis_ENSTNIP00000021125 | paralogy | Tetraodon |
| F20D6.11 | paralogy | Worm |
| AIFM3 | paralogy | Xenopus |
| T_guttata_ENSTGUP00000005877 | paralogy | Zebra finch |
| AIFM3 | paralogy | Zebra finch |
| LOC569177 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0008152 | metabolic process | biological_proccess | IEA |
| GO:0045454 | cell redox homeostasis | biological_proccess | IEA |
| GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | biological_proccess | TAS |
| GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | TAS |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0055114 | oxidation reduction | biological_proccess | IEA |
| GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | IEA |
| GO:0030263 | apoptotic chromosome condensation | biological_proccess | IEA |
| GO:0051402 | neuron apoptosis | biological_proccess | IEA |
| GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
| GO:0050660 | FAD binding | mollecular_function | IEA |
| GO:0003824 | catalytic activity | mollecular_function | IEA |
| GO:0005488 | binding | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0009055 | electron carrier activity | mollecular_function | TAS |
| GO:0003677 | DNA binding | mollecular_function | IEA |
| GO:0005737 | cytoplasm | cell_component | IEA |
| GO:0005634 | nucleus | cell_component | TAS |
| GO:0005739 | mitochondrion | cell_component | TAS |
| GO:0005758 | mitochondrial intermembrane space | cell_component | IEA |
| GO:0005634 | nucleus | cell_component | IEA |
| GO:0005739 | mitochondrion | cell_component | IEA |
| GO:0005792 | microsome | cell_component | IEA |
| GO:0005625 | soluble fraction | cell_component | IEA |
Check GO Evidence Codes here
Curated Isoforms [+]
| Transcript | Translation |
|---|---|
| OTTHUMT00000058247 * | OTTHUMP00000024007 * |
| OTTHUMT00000058248 | OTTHUMP00000024008 |
| OTTHUMT00000058249 | OTTHUMP00000024009 |
| OTTHUMT00000058250 |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :8768
- Gene related info from GeneCards [?] : AIF
- Ensembl genome browser [?] : ENSG00000156709
- Expression info from Arrayexpress [?] : ENSG00000156709
- Protein expression from Protein Atlas: [?] ENSG00000156709
- Community gene edition from Wikigenes: [?] 9131
- OMIM gene information: 300169
- OMIM disease information:
- entrezgene: 9131
- refseq_dna: NM_001130847
- refseq_dna: NM_001130846
- refseq_dna: NM_004208
- refseq_dna: NM_145812
- refseq_dna: NM_145813
- refseq_peptide: NP_004199
- refseq_peptide: NP_001124319
- refseq_peptide: NP_001124318
- refseq_peptide: NP_665811
- refseq_peptide: NP_665812
Click on [?] for more information.


