MOAP1 (Homo sapiens)
Description [+]
- Synonyms: MOAP1, MAP-1, PNMA4
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Modulator of apoptosis 1 (MAP-1)(MAP1)(Paraneoplastic antigen Ma4) [Source:UniProtKB/Swiss-Prot;Acc:Q96BY2]
- Family: other
- Process: apoptosis,
- Pathways: intrinsic pathway, pre-mitochondrial signaling events,
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Moap1
- WIKI: MOAP1-H_sapiens
References [+]
- MAP-1 is a mitochondrial effector of Bax.
- Tan KO, Fu NY, Sukumaran SK, Chan SL, Kang JH, Poon KL, Chen BS, Yu VC
- Apoptotic stimuli induce conformational changes in Bax and trigger its translocation from cytosol to mitochondria. Upon assembling into the mitochondrial membrane, Bax initiates a death program through a series of events, culminating in the release of apoptogenic factors such as cytochrome c. Although it is known that Bax is one of the key factors for integrating multiple death signals, the mechanism by which Bax functions in mitochondria remains controversial. We have previously identified modulator of apoptosis-1 (MAP-1) as a Bax-associating protein, but its functional relationship with Bax in contributing to apoptosis regulation remains to be established. In this study, we show that MAP-1 is a critical mitochondrial effector of Bax. MAP-1 is a mitochondria-enriched protein that associates with Bax only upon apoptotic induction, which coincides with the release of cytochrome c from mitochondria. Small interfering RNAs that diminish MAP-1 levels in mammalian cell lines confer selective inhibition of Bax-mediated apoptosis. Mammalian cells with stable expression of MAP-1 small interfering RNAs are resistant to multiple apoptotic stimuli in triggering apoptotic death as well as in inducing conformation change and translocation of Bax. Similar to Bax-deficient cells, MAP-1-deficient cells exhibit aggressive anchorage-independent growth. Remarkably, recombinant Bax- or tBid-mediated release of cytochrome c from isolated mitochondria is significantly compromised in the MAP-1 knockdown cells. We propose that MAP-1 is a direct mitochondrial target of Bax. Proc Natl Acad Sci U S A. 2005 Oct 11;102(41):14623-8. Epub 2005 Sep 30.
Structure & Sequence [+]
Protein sequence [+]
MOAP1 | Homo sapiens | 9606 | length:351
MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDE
NRKVALVGLTAETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGEL
SRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEE
FGRWMFHTTQMIKAWQVPDVEKRRRLLESLRGPALDVIRVLKINNPLITVDECLQALEEV
FGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIA
GAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNFT
NRKVALVGLTAETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGEL
SRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEE
FGRWMFHTTQMIKAWQVPDVEKRRRLLESLRGPALDVIRVLKINNPLITVDECLQALEEV
FGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIA
GAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNFT
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| MOAP1 | orthology | Chimpanzee |
| MOAP1 | orthology | Gorilla |
| M_mulatta_ENSMMUP00000038671 | orthology | Macaca |
| M_mulatta_ENSMMUP00000041359 | orthology | Macaca |
| Moap1 | orthology | Mouse |
| MOAP1 | orthology | Orangutan |
| Moap1 | orthology | Rat |
| LOC690057 | orthology | Rat |
| PNMA1 | paralogy | Chimpanzee |
| PNMAL1 | paralogy | Chimpanzee |
| ZCCHC12 | paralogy | Chimpanzee |
| PNMA2 | paralogy | Chimpanzee |
| PNMA5 | paralogy | Chimpanzee |
| PNMA1_BOVIN | paralogy | Cow |
| PNML1_BOVIN | paralogy | Cow |
| ZCH12_BOVIN | paralogy | Cow |
| PNMA2_BOVIN | paralogy | Cow |
| PNMAL1 | paralogy | Dog |
| PNMA2 | paralogy | Dog |
| PNMA1 | paralogy | Dog |
| C_familiaris_ENSCAFP00000028289 | paralogy | Dog |
| C_familiaris_ENSCAFP00000028290 | paralogy | Dog |
| C_familiaris_ENSCAFP00000031431 | paralogy | Dog |
| PNMA5 | paralogy | Gorilla |
| PNMAL1 | paralogy | Gorilla |
| PNMA1 | paralogy | Gorilla |
| PNMA2 | paralogy | Gorilla |
| G_gorilla_ENSGGOP00000013467 | paralogy | Gorilla |
| PNMA3 | paralogy | Gorilla |
| PNMA5 | paralogy | Horse |
| PNMA3 | paralogy | Horse |
| E_caballus_ENSECAP00000002503 | paralogy | Horse |
| PNMA1 | paralogy | Horse |
| PNMAL1 | paralogy | Horse |
| PNMA2 | paralogy | Horse |
| E_caballus_ENSECAP00000012350 | paralogy | Horse |
| PNMA2 | paralogy | Human |
| ZCCHC12 | paralogy | Human |
| PNMAL1 | paralogy | Human |
| PNMA1 | paralogy | Human |
| PNMA5 | paralogy | Human |
| PNMA6B | paralogy | Human |
| PNMA6A | paralogy | Human |
| PNMA3 | paralogy | Human |
| Z82254.1 | paralogy | Human |
| PNMA1 | paralogy | Macaca |
| PNMAL1 | paralogy | Macaca |
| PNMA3 | paralogy | Macaca |
| PNMA5 | paralogy | Macaca |
| ZCCHC12 | paralogy | Macaca |
| PNMA5 | paralogy | Medaka |
| Pnmal1 | paralogy | Mouse |
| Zcchc12 | paralogy | Mouse |
| Pnma3 | paralogy | Mouse |
| Pnma1 | paralogy | Mouse |
| Pnma5 | paralogy | Mouse |
| Pnma2 | paralogy | Mouse |
| Zcchc18 | paralogy | Mouse |
| AC165148.2 | paralogy | Mouse |
| ZCCHC12 | paralogy | Orangutan |
| PNMA3 | paralogy | Orangutan |
| P_pygmaeus_ENSPPYP00000023320 | paralogy | Orangutan |
| P_pygmaeus_ENSPPYP00000023324 | paralogy | Orangutan |
| PNMA1 | paralogy | Orangutan |
| PNMA2_PONPY | paralogy | Orangutan |
| PNMAL1 | paralogy | Rabbit |
| PNMA1 | paralogy | Rabbit |
| O_cuniculus_ENSOCUP00000006778 | paralogy | Rabbit |
| NP_001100742.1 | paralogy | Rat |
| Pnma1 | paralogy | Rat |
| Zcchc12 | paralogy | Rat |
| NP_001099812.1 | paralogy | Rat |
| NP_001101049.1 | paralogy | Rat |
| X_tropicalis_ENSXETP00000039695 | paralogy | Xenopus |
| X_tropicalis_ENSXETP00000050115 | paralogy | Xenopus |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006919 | activation of caspase activity | biological_proccess | IDA |
| GO:0006921 | cell structure disassembly during apoptosis | biological_proccess | IDA |
| GO:0030262 | apoptotic nuclear changes | biological_proccess | IDA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0042803 | protein homodimerization activity | mollecular_function | IPI |
| GO:0005737 | cytoplasm | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :16658
- Gene related info from GeneCards [?] : MOAP1
- Ensembl genome browser [?] : ENSG00000165943
- Expression info from Arrayexpress [?] : ENSG00000165943
- Protein expression from Protein Atlas: [?] ENSG00000165943
- Community gene edition from Wikigenes: [?] 64112
- OMIM gene information: 609485
- OMIM disease information:
Click on [?] for more information.
