PYDC1 (Homo sapiens)
Description [+]
- Synonyms: PYDC1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Pyrin domain-containing protein 1 (Pyrin-only protein 1)(PAAD-only protein 1) [Source:UniProtKB/Swiss-Prot;Acc:Q8WXC3]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PYDC1-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | PAAD_DAPIN | 4 | 87 |
Protein sequence [+]
PYDC1 | Homo sapiens | 9606 | length:89
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASY
YEDYAAELVVAVLRDMRMLEEAARLQRAA
YEDYAAELVVAVLRDMRMLEEAARLQRAA
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006469 | negative regulation of protein kinase activity | biological_proccess | IDA |
GO:0033209 | tumor necrosis factor-mediated signaling pathway | biological_proccess | IDA |
GO:0045087 | innate immune response | biological_proccess | IDA |
GO:0050718 | positive regulation of interleukin-1 beta secretion | biological_proccess | IDA |
GO:0032088 | negative regulation of NF-kappaB transcription factor activity | biological_proccess | IDA |
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0005829 | cytosol | cell_component | IDA |
GO:0008385 | IkappaB kinase complex | cell_component | IDA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :30261
- Gene related info from GeneCards [?] : PYDC1
- Ensembl genome browser [?] : ENSG00000169900
- Expression info from Arrayexpress [?] : ENSG00000169900
- Protein expression from Protein Atlas: [?] ENSG00000169900
- Community gene edition from Wikigenes: [?] 260434
Click on [?] for more information.