TRAF6 (Homo sapiens)
Description [+]
- Synonyms: TRAF6
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: TNF receptor-associated factor 6 (Interleukin-1 signal transducer)(RING finger protein 85) [Source:UniProtKB/Swiss-Prot;Acc:Q9Y4K3]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TRAF6-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | zf-C3HC4 | 70 | 108 |
PFAM A | zf-TRAF | 151 | 202 |
PFAM A | zf-TRAF | 204 | 261 |
PFAM A | MATH | 357 | 501 |
Protein sequence [+]
TRAF6 | Homo sapiens | 9606 | length:522
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Structure links:
- Smartdomain prediction information: SM00504
- Smartdomain prediction information: SM00184
- Smartdomain prediction information: SM00061
- Prosite motif and domain information: PS00518
- Profile motif and domain profile information: PS50144
- Profile motif and domain profile information: PS50089
- Profile motif and domain profile information: PS50145
- Interpro domain information: Q9Y4K3
- PFAM domain and domain family information: Q9Y4K3
- Protein 3D structures from PDB: 2JMD 1LB4 1LB5 2ECI 1LB6
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0019941 | modification-dependent protein catabolic process | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEP |
GO:0032743 | positive regulation of interleukin-2 production | biological_proccess | IMP |
GO:0002726 | positive regulation of T cell cytokine production | biological_proccess | IMP |
GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | IMP |
GO:0050870 | positive regulation of T cell activation | biological_proccess | IC |
GO:0000209 | protein polyubiquitination | biological_proccess | IDA |
GO:0050852 | T cell receptor signaling pathway | biological_proccess | IMP |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0019886 | antigen processing and presentation of exogenous peptide antigen via MHC class II | biological_proccess | IEA |
GO:0001503 | ossification | biological_proccess | IEA |
GO:0042475 | odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0001843 | neural tube closure | biological_proccess | IEA |
GO:0045084 | positive regulation of interleukin-12 biosynthetic process | biological_proccess | IEA |
GO:0045410 | positive regulation of interleukin-6 biosynthetic process | biological_proccess | IEA |
GO:0043011 | myeloid dendritic cell differentiation | biological_proccess | IEA |
GO:0042088 | T-helper 1 type immune response | biological_proccess | IEA |
GO:0048468 | cell development | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0016567 | protein ubiquitination | biological_proccess | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004842 | ubiquitin-protein ligase activity | mollecular_function | IDA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0005829 | cytosol | cell_component | EXP |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | IEA |
GO:0000151 | ubiquitin ligase complex | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :12036
- Gene related info from GeneCards [?] : TRAF6
- Ensembl genome browser [?] : ENSG00000175104
- Expression info from Arrayexpress [?] : ENSG00000175104
- Protein expression from Protein Atlas: [?] ENSG00000175104
- Community gene edition from Wikigenes: [?] 7189
- OMIM gene information: 602355
- OMIM disease information:
Click on [?] for more information.