MALT1 (Homo sapiens)
Description [+]
- Synonyms: MALT1,
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (EC 3.4.22.-)(MALT lymphoma-associated translocation)(Paracaspase) [Source:UniProtKB/Swiss-Prot;Acc:Q9UDY8]
- Family: other
- Process: immunity,
- Pathways:
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Malt1
- WIKI: MALT1-H_sapiens
References [+]
- Regulation of NF-kappaB-dependent lymphocyte activation and development by paracaspase.
- Ruefli-Brasse AA, French DM, Dixit VM
- Paracaspase (MALT1), a member of an evolutionarily conserved superfamily of caspase-like proteins, has been shown to bind and colocalize with the protein Bcl10 in vitro and, because of this association, has been suggested to be involved in the CARMA1-Bcl10 pathway of antigen-induced nuclear factor kappaB (NF-kappaB) activation. We demonstrate that primary T and B lymphocytes from paracaspase-deficient mice are defective in antigen-receptor-induced NF-kappaB activation, cytokine production, and proliferation. Paracaspase acts downstream of Bcl10 to induce NF-kappaB activation and is required for the normal development of B cells, indicating that paracaspase provides the missing link between Bcl10 and activation of the IkappaB kinase complex. Science. 2003 Nov 28;302(5650):1581-4. Epub 2003 Oct 23.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ig | 141 | 192 |
PFAM A | ig | 241 | 292 |
PFAM A | Peptidase_C14 | 343 | 561 |
Protein sequence [+]
MALT1 | Homo sapiens | 9606 | length:824
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLK
APLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDAL
KVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCH
LTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQI
QLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVS
KDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRG
LGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCS
RTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLK
APLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDAL
KVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCH
LTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQI
QLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVS
KDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRG
LGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCS
RTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK
Structure links:
- Smartdomain prediction information: SM00005
- Smartdomain prediction information: SM00409
- Smartdomain prediction information: SM00408
- Smartdomain prediction information: SM00115
- Profile motif and domain profile information: PS50208
- Profile motif and domain profile information: PS50835
- Interpro domain information: Q9UDY8
- PFAM domain and domain family information: Q9UDY8
- Protein 3D structures from PDB: 2G7R
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
MALT1 | orthology | Chicken |
MALT1 | orthology | Chimpanzee |
MALT1 | orthology | Cow |
MALT1 | orthology | Dog |
MALT1 | orthology | Fugu |
MALT1 | orthology | Gasterosteus |
MALT1 | orthology | Horse |
MALT1 | orthology | Lyzard |
MALT1 | orthology | Macaca |
MALT1 | orthology | Medaka |
MALT1 | orthology | Monodelphis |
Malt1 | orthology | Mouse |
MALT1 | orthology | Orangutan |
O_anatinus_ENSOANP00000005450 | orthology | Ornithorhynchus |
MALT1 | orthology | Rabbit |
Malt1_predicted | orthology | Rat |
MALT1 | orthology | Tetraodon |
MALT1 | orthology | Xenopus |
MALT1 | orthology | Zebra finch |
T_rubripes_ENSTRUP00000010052 | paralogy | Fugu |
CD22 | paralogy | Fugu |
T_rubripes_ENSTRUP00000010990 | paralogy | Fugu |
O_latipes_ENSORLP00000021230 | paralogy | Medaka |
HMCN2 | paralogy | Monodelphis |
T_nigroviridis_ENSTNIP00000022449 | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000018539 | paralogy | Tetraodon |
F22D3.6 | paralogy | Worm |
T_guttata_ENSTGUP00000000140 | paralogy | Zebra finch |
malt1 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IDA |
GO:0019941 | modification-dependent protein catabolic process | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | NAS |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IMP |
GO:0051168 | nuclear export | biological_proccess | IDA |
GO:0032743 | positive regulation of interleukin-2 production | biological_proccess | IMP |
GO:0050852 | T cell receptor signaling pathway | biological_proccess | IDA |
GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | IMP |
GO:0002726 | positive regulation of T cell cytokine production | biological_proccess | IMP |
GO:0051259 | protein oligomerization | biological_proccess | IDA |
GO:0050870 | positive regulation of T cell activation | biological_proccess | IC |
GO:0006952 | defense response | biological_proccess | NAS |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0050870 | positive regulation of T cell activation | biological_proccess | IEA |
GO:0002237 | response to molecule of bacterial origin | biological_proccess | IEA |
GO:0042098 | T cell proliferation | biological_proccess | IEA |
GO:0042113 | B cell activation | biological_proccess | IEA |
GO:0050856 | regulation of T cell receptor signaling pathway | biological_proccess | IEA |
GO:0009620 | response to fungus | biological_proccess | IEA |
GO:0001923 | B-1 B cell differentiation | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | NAS |
GO:0004871 | signal transducer activity | mollecular_function | IMP |
GO:0004842 | ubiquitin-protein ligase activity | mollecular_function | IDA |
GO:0019209 | kinase activator activity | mollecular_function | IMP |
GO:0043621 | protein self-association | mollecular_function | IPI |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0005829 | cytosol | cell_component | EXP |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0032449 | CBM complex | cell_component | NAS |
GO:0005829 | cytosol | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Curated Isoforms [+]
Transcript | Translation |
---|---|
OTTHUMT00000256132 * | OTTHUMP00000163647 * |
OTTHUMT00000256133 | OTTHUMP00000163648 |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :6819
- Gene related info from GeneCards [?] : MALT1
- Ensembl genome browser [?] : ENSG00000172175
- Expression info from Arrayexpress [?] : ENSG00000172175
- Protein expression from Protein Atlas: [?] ENSG00000172175
- Community gene edition from Wikigenes: [?] 10892
- OMIM gene information: 604860
- OMIM disease information:
Click on [?] for more information.