PRDX6 (Homo sapiens)
Description [+]
- Synonyms: PRDX6
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Peroxiredoxin-6 (EC 1.11.1.15)(Antioxidant protein 2)(1-Cys peroxiredoxin)(1-Cys PRX)(Acidic calcium-independent phospholipase A2)(aiPLA2)(EC 3.1.1.-)(Non-selenium glutathione peroxidase)(NSGPx)(EC 1.11.1.7)(24 kDa protein)(Liver 2D page spot 40)(Red blood cells page spot 12) [Source:UniProtKB/Swiss-Prot;Acc:P30041]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX6-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | AhpC-TSA | 7 | 146 |
PFAM A | 1-cysPrx_C | 156 | 218 |
Protein sequence [+]
PRDX6 | Homo sapiens | 9606 | length:224
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPA
EKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
FAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPA
EKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0045454 | cell redox homeostasis | biological_proccess | IEA |
GO:0016042 | lipid catabolic process | biological_proccess | IEA |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0009395 | phospholipid catabolic process | biological_proccess | IDA |
GO:0006979 | response to oxidative stress | biological_proccess | IDA |
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | IEA |
GO:0051920 | peroxiredoxin activity | mollecular_function | IEA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0004623 | phospholipase A2 activity | mollecular_function | IDA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0004602 | glutathione peroxidase activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005764 | lysosome | cell_component | IEA |
GO:0031410 | cytoplasmic vesicle | cell_component | IEA |
GO:0005829 | cytosol | cell_component | NAS |
GO:0005634 | nucleus | cell_component | IDA |
Check GO Evidence Codes here
KEGG Pathways [+]
miRNAs [+]
miRNA | Regulation | Description | Pubmed |
---|---|---|---|
mmu-miR-672 | overexpression | At 3 months, RT-PCR, realtime PCR and western blot analysis of the clone cells demonstrated decreased PRDX6 expression compared with parental cells (P < 0.05; Additional file 2). | Ref. |
mmu-miR-672 | overexpression | At 3 months, RT-PCR, realtime PCR and western blot analysis of the clone cells demonstrated decreased PRDX6 expression compared with parental cells (P < 0.05; Additional file 2). | Ref. |
Information from other databases [+]
- Gene info from HGNC [?] :16753
- Gene related info from GeneCards [?] : PRDX6
- Ensembl genome browser [?] : ENSG00000117592
- Expression info from Arrayexpress [?] : ENSG00000117592
- Protein expression from Protein Atlas: [?] ENSG00000117592
- Community gene edition from Wikigenes: [?] 9588
- OMIM gene information: 602316
- OMIM disease information:
Click on [?] for more information.