ANXA2 (Homo sapiens)
Description [+]
- Synonyms: ANXA2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Annexin A2 (Annexin-2)(Annexin II)(Lipocortin II)(Calpactin I heavy chain)(Chromobindin-8)(p36)(Protein I)(Placental anticoagulant protein IV)(PAP-IV) [Source:UniProtKB/Swiss-Prot;Acc:P07355]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ANXA2-H_sapiens
Structure & Sequence [+]
Protein sequence [+]
ANXA2 | Homo sapiens | 9606 | length:357
MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNI
ETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGL
LKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISD
TSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSV
PHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKG
TRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
ETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGL
LKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISD
TSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSV
PHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKG
TRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0050819 | negative regulation of coagulation | biological_proccess | IEA |
GO:0030199 | collagen fibril organization | biological_proccess | IEA |
GO:0001525 | angiogenesis | biological_proccess | IEA |
GO:0042730 | fibrinolysis | biological_proccess | IEA |
GO:0001501 | skeletal system development | biological_proccess | TAS |
GO:0007589 | body fluid secretion | biological_proccess | IEA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005544 | calcium-dependent phospholipid binding | mollecular_function | IEA |
GO:0004859 | phospholipase inhibitor activity | mollecular_function | IEA |
GO:0008092 | cytoskeletal protein binding | mollecular_function | IEA |
GO:0005546 | phosphatidylinositol-4,5-bisphosphate binding | mollecular_function | IEA |
GO:0004859 | phospholipase inhibitor activity | mollecular_function | TAS |
GO:0017137 | Rab GTPase binding | mollecular_function | IEA |
GO:0005769 | early endosome | cell_component | IEA |
GO:0042383 | sarcolemma | cell_component | IEA |
GO:0043234 | protein complex | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005625 | soluble fraction | cell_component | TAS |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005604 | basement membrane | cell_component | IEA |
GO:0042470 | melanosome | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSG00000182718
- Expression info from Arrayexpress [?] : ENSG00000182718
- Protein expression from Protein Atlas: [?] ENSG00000182718
Click on [?] for more information.