HTRA1 (Homo sapiens)
Description [+]
- Synonyms: HTRA1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Serine protease HTRA1 Precursor (EC 3.4.21.-)(L56)(Serine protease 11) [Source:UniProtKB/Swiss-Prot;Acc:Q92743]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: HTRA1-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Kazal_1 | 102 | 155 |
PFAM A | Kazal_2 | 109 | 155 |
PFAM A | Trypsin | 193 | 364 |
PFAM A | PDZ | 370 | 463 |
Protein sequence [+]
HTRA1 | Homo sapiens | 9606 | length:480
MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARD
ACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCG
SDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIA
PAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEA
KIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTT
QRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKI
KKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPD
TPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP
ACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCG
SDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIA
PAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEA
KIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTT
QRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKI
KKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPD
TPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP
Structure links:
- Smartdomain prediction information: SM00121
- Smartdomain prediction information: SM00280
- Smartdomain prediction information: SM00228
- Profile motif and domain profile information: PS50106
- Interpro domain information: Q92743
- PFAM domain and domain family information: Q92743
- Protein 3D structures from PDB: 2JOA
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0030514 | negative regulation of BMP signaling pathway | biological_proccess | IEA |
GO:0001558 | regulation of cell growth | biological_proccess | IEA |
GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway | biological_proccess | IEA |
GO:0004252 | serine-type endopeptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008236 | serine-type peptidase activity | mollecular_function | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0005520 | insulin-like growth factor binding | mollecular_function | IEA |
GO:0004252 | serine-type endopeptidase activity | mollecular_function | TAS |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | TAS |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :9476
- Gene related info from GeneCards [?] : HTRA1
- Ensembl genome browser [?] : ENSG00000166033
- Expression info from Arrayexpress [?] : ENSG00000166033
- Protein expression from Protein Atlas: [?] ENSG00000166033
- Community gene edition from Wikigenes: [?] 5654
Click on [?] for more information.