TNFSF15 (Homo sapiens)
Description [+]
- Synonyms: TNFSF15
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor ligand superfamily member 15 (Vascular endothelial cell growth inhibitor)(TNF ligand-related molecule 1) [Contains Tumor necrosis factor ligand superfamily member 15, membrane form;Tumor necrosis factor ligand superfamily member 15, secreted form] [Source:UniProtKB/Swiss-Prot;Acc:O95150]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFSF15-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 117 | 251 |
Protein sequence [+]
TNFSF15 | Homo sapiens | 9606 | length:251
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLR
AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE
HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV
ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
EDKTFFGAFLL
AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE
HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV
ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
EDKTFFGAFLL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IDA |
GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | IDA |
GO:0042107 | cytokine metabolic process | biological_proccess | IDA |
GO:0007165 | signal transduction | biological_proccess | NAS |
GO:0001937 | negative regulation of endothelial cell proliferation | biological_proccess | IDA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005123 | death receptor binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IDA |
GO:0005887 | integral to plasma membrane | cell_component | TAS |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :11931
- Gene related info from GeneCards [?] : TNFSF15
- Ensembl genome browser [?] : ENSG00000181634
- Expression info from Arrayexpress [?] : ENSG00000181634
- Protein expression from Protein Atlas: [?] ENSG00000181634
- Community gene edition from Wikigenes: [?] 9966
- OMIM gene information: 604052
- OMIM disease information:
Click on [?] for more information.