SH3GL2 (Homo sapiens)
Description [+]
- Synonyms: SH3GL2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Endophilin-A1 (Endophilin-1)(SH3 domain-containing GRB2-like protein 2)(SH3 domain protein 2A)(EEN-B1) [Source:UniProtKB/Swiss-Prot;Acc:Q99962]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: SH3GL2-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BAR | 6 | 242 |
PFAM A | SH3_1 | 293 | 347 |
PFAM A | SH3_2 | 294 | 347 |
Protein sequence [+]
SH3GL2 | Homo sapiens | 9606 | length:352
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
Structure links:
- Smartdomain prediction information: SM00721
- Smartdomain prediction information: SM00326
- Profile motif and domain profile information: PS51021
- Profile motif and domain profile information: PS50002
- Interpro domain information: Q99962
- PFAM domain and domain family information: Q99962
- Protein 3D structures from PDB: 1X03
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | TAS |
GO:0007417 | central nervous system development | biological_proccess | TAS |
GO:0006897 | endocytosis | biological_proccess | IEA |
GO:0048489 | synaptic vesicle transport | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IPI |
GO:0008289 | lipid binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005829 | cytosol | cell_component | EXP |
GO:0005886 | plasma membrane | cell_component | EXP |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :10831
- Gene related info from GeneCards [?] : SH3GL2
- Ensembl genome browser [?] : ENSG00000107295
- Expression info from Arrayexpress [?] : ENSG00000107295
- Protein expression from Protein Atlas: [?] ENSG00000107295
- Community gene edition from Wikigenes: [?] 6456
- OMIM gene information: 604465
- OMIM disease information:
Click on [?] for more information.